Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K0KCR4

Protein Details
Accession K0KCR4    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-26ADNGRPSLKKLSKRVLRKTIQKGVHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR047021  REXO1/3/4-like  
IPR036397  RNaseH_sf  
Gene Ontology GO:0004527  F:exonuclease activity  
GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MADNGRPSLKKLSKRVLRKTIQKGVHDSEEDAKATMDLVKKKRYGRSFRMFKIRYTGEEPQKIKLANDPQRYLAGRYALIDGVKSFQNNYINNW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.81
3 0.8
4 0.81
5 0.83
6 0.84
7 0.82
8 0.8
9 0.74
10 0.69
11 0.64
12 0.59
13 0.5
14 0.42
15 0.37
16 0.32
17 0.28
18 0.22
19 0.18
20 0.13
21 0.12
22 0.14
23 0.14
24 0.18
25 0.22
26 0.26
27 0.31
28 0.36
29 0.43
30 0.49
31 0.53
32 0.56
33 0.62
34 0.64
35 0.64
36 0.7
37 0.64
38 0.56
39 0.55
40 0.47
41 0.4
42 0.39
43 0.42
44 0.38
45 0.45
46 0.45
47 0.41
48 0.43
49 0.4
50 0.35
51 0.34
52 0.37
53 0.38
54 0.44
55 0.44
56 0.42
57 0.46
58 0.47
59 0.43
60 0.36
61 0.29
62 0.23
63 0.22
64 0.22
65 0.19
66 0.17
67 0.16
68 0.13
69 0.13
70 0.14
71 0.14
72 0.14
73 0.18
74 0.25