Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K0KIZ4

Protein Details
Accession K0KIZ4    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
307-326TTRLSLKKGKGEQRICKIYDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cysk 8, pero 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR011941  DNA_recomb/repair_Rad51  
IPR013632  DNA_recomb/repair_Rad51_C  
IPR016467  DNA_recomb/repair_RecA-like  
IPR010995  DNA_repair_Rad51/TF_NusA_a-hlx  
IPR027417  P-loop_NTPase  
IPR020588  RecA_ATP-bd  
IPR020587  RecA_monomer-monomer_interface  
Gene Ontology GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0140664  F:ATP-dependent DNA damage sensor activity  
GO:0000150  F:DNA strand exchange activity  
GO:0003690  F:double-stranded DNA binding  
GO:0003697  F:single-stranded DNA binding  
GO:0000724  P:double-strand break repair via homologous recombination  
GO:1990426  P:mitotic recombination-dependent replication fork processing  
GO:0007131  P:reciprocal meiotic recombination  
Pfam View protein in Pfam  
PF08423  Rad51  
PROSITE View protein in PROSITE  
PS50162  RECA_2  
PS50163  RECA_3  
CDD cd19513  Rad51  
Amino Acid Sequences MTEGEHQQSQSQDPQQEHQQQDVEDEDDLYGPIPITKLEGNGITGGDIRKLMEAGYNTVEAIAYTPKRALLTVKGISEAKSDKLLAEASKLVPMGFTTASEFHHRRSELICLTTGSKQLDTLLGGGIETGSITELFGEFRTGKSQLCHTLAVTCQLPIDMGGGEGKCLYIDTEGTFRPVRLVSIARRYGLNEDDALDNVAYARAYNADHQLQLLNQAAAMMSESRFSLLIVDSIMALYRTDFAGRGELSARQMHVAKYMRTLQRLADEFGIAVVITNQVVAQVDGGMMFNPDPKKPIGGNIIAHSSTTRLSLKKGKGEQRICKIYDSPCLPESETVFAIYEDGIGDPKDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.49
3 0.56
4 0.54
5 0.51
6 0.48
7 0.43
8 0.43
9 0.4
10 0.31
11 0.23
12 0.21
13 0.16
14 0.13
15 0.13
16 0.1
17 0.09
18 0.07
19 0.08
20 0.07
21 0.07
22 0.1
23 0.1
24 0.11
25 0.13
26 0.14
27 0.14
28 0.15
29 0.15
30 0.13
31 0.14
32 0.14
33 0.12
34 0.12
35 0.11
36 0.11
37 0.11
38 0.11
39 0.13
40 0.13
41 0.15
42 0.17
43 0.16
44 0.15
45 0.15
46 0.15
47 0.11
48 0.11
49 0.14
50 0.13
51 0.14
52 0.14
53 0.16
54 0.17
55 0.17
56 0.19
57 0.18
58 0.25
59 0.27
60 0.27
61 0.29
62 0.29
63 0.29
64 0.3
65 0.26
66 0.2
67 0.19
68 0.19
69 0.16
70 0.17
71 0.18
72 0.14
73 0.15
74 0.16
75 0.14
76 0.15
77 0.15
78 0.13
79 0.11
80 0.11
81 0.11
82 0.09
83 0.09
84 0.09
85 0.1
86 0.13
87 0.2
88 0.21
89 0.21
90 0.27
91 0.27
92 0.27
93 0.27
94 0.31
95 0.27
96 0.28
97 0.26
98 0.21
99 0.23
100 0.23
101 0.25
102 0.2
103 0.17
104 0.16
105 0.15
106 0.15
107 0.13
108 0.12
109 0.08
110 0.07
111 0.06
112 0.06
113 0.05
114 0.04
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.04
123 0.04
124 0.07
125 0.06
126 0.07
127 0.1
128 0.11
129 0.12
130 0.13
131 0.16
132 0.19
133 0.21
134 0.21
135 0.18
136 0.19
137 0.19
138 0.2
139 0.17
140 0.12
141 0.1
142 0.09
143 0.09
144 0.07
145 0.07
146 0.04
147 0.04
148 0.06
149 0.05
150 0.06
151 0.06
152 0.05
153 0.05
154 0.05
155 0.05
156 0.04
157 0.04
158 0.05
159 0.07
160 0.07
161 0.1
162 0.11
163 0.1
164 0.11
165 0.11
166 0.1
167 0.1
168 0.13
169 0.14
170 0.21
171 0.23
172 0.22
173 0.23
174 0.23
175 0.23
176 0.21
177 0.19
178 0.12
179 0.11
180 0.11
181 0.11
182 0.11
183 0.08
184 0.07
185 0.06
186 0.06
187 0.04
188 0.04
189 0.04
190 0.05
191 0.05
192 0.07
193 0.11
194 0.12
195 0.12
196 0.12
197 0.13
198 0.12
199 0.14
200 0.13
201 0.09
202 0.08
203 0.08
204 0.07
205 0.07
206 0.07
207 0.05
208 0.04
209 0.05
210 0.05
211 0.06
212 0.06
213 0.06
214 0.06
215 0.06
216 0.06
217 0.06
218 0.06
219 0.05
220 0.05
221 0.06
222 0.05
223 0.04
224 0.04
225 0.05
226 0.05
227 0.06
228 0.06
229 0.07
230 0.1
231 0.1
232 0.11
233 0.11
234 0.13
235 0.15
236 0.16
237 0.16
238 0.15
239 0.17
240 0.16
241 0.22
242 0.24
243 0.22
244 0.25
245 0.33
246 0.34
247 0.35
248 0.36
249 0.3
250 0.34
251 0.35
252 0.33
253 0.26
254 0.22
255 0.2
256 0.18
257 0.17
258 0.09
259 0.07
260 0.05
261 0.04
262 0.04
263 0.04
264 0.04
265 0.05
266 0.05
267 0.05
268 0.05
269 0.05
270 0.05
271 0.05
272 0.06
273 0.05
274 0.05
275 0.06
276 0.1
277 0.12
278 0.13
279 0.16
280 0.16
281 0.21
282 0.21
283 0.27
284 0.28
285 0.31
286 0.33
287 0.34
288 0.37
289 0.33
290 0.32
291 0.27
292 0.21
293 0.17
294 0.18
295 0.2
296 0.17
297 0.23
298 0.32
299 0.38
300 0.46
301 0.54
302 0.59
303 0.66
304 0.74
305 0.78
306 0.79
307 0.8
308 0.73
309 0.68
310 0.64
311 0.57
312 0.56
313 0.51
314 0.46
315 0.4
316 0.41
317 0.39
318 0.37
319 0.36
320 0.31
321 0.28
322 0.24
323 0.22
324 0.19
325 0.18
326 0.14
327 0.12
328 0.08
329 0.08
330 0.09
331 0.08
332 0.09