Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KLH4

Protein Details
Accession K0KLH4   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
43-72TPSTTPSKITKPKKKSKKLCQYKQCTNQHSHydrophilic
NLS Segment(s)
PositionSequence
53-60KPKKKSKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0003677  F:DNA binding  
GO:0016787  F:hydrolase activity  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF01428  zf-AN1  
Amino Acid Sequences MSQTTSQPSSQVPAPASSQEPVQQSQESINNESQIQQELKESTPSTTPSKITKPKKKSKKLCQYKQCTNQHSIIGDCQFCVKKFCTTHRLLEAHDCEHYREVKNEYHERNAKLLQSQQTVVSKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.27
4 0.24
5 0.22
6 0.22
7 0.24
8 0.23
9 0.25
10 0.22
11 0.21
12 0.24
13 0.28
14 0.26
15 0.27
16 0.26
17 0.25
18 0.24
19 0.25
20 0.22
21 0.2
22 0.18
23 0.14
24 0.15
25 0.16
26 0.17
27 0.18
28 0.18
29 0.15
30 0.17
31 0.2
32 0.21
33 0.21
34 0.22
35 0.23
36 0.31
37 0.39
38 0.47
39 0.54
40 0.61
41 0.69
42 0.78
43 0.85
44 0.87
45 0.89
46 0.9
47 0.91
48 0.91
49 0.9
50 0.88
51 0.87
52 0.87
53 0.84
54 0.77
55 0.69
56 0.62
57 0.54
58 0.46
59 0.37
60 0.3
61 0.24
62 0.2
63 0.16
64 0.17
65 0.17
66 0.16
67 0.19
68 0.18
69 0.22
70 0.26
71 0.32
72 0.36
73 0.39
74 0.44
75 0.48
76 0.48
77 0.42
78 0.47
79 0.44
80 0.37
81 0.37
82 0.32
83 0.27
84 0.29
85 0.32
86 0.26
87 0.27
88 0.29
89 0.31
90 0.38
91 0.45
92 0.46
93 0.51
94 0.55
95 0.54
96 0.55
97 0.54
98 0.49
99 0.45
100 0.47
101 0.44
102 0.42
103 0.4
104 0.41