Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KWZ3

Protein Details
Accession K0KWZ3   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
30-49MDWFKMKKDQKEVEKKNEIKHydrophilic
209-238TPVSDHKADKKYKKLLKKARKDQLLKSEQLHydrophilic
NLS Segment(s)
PositionSequence
218-229KKYKKLLKKARK
Subcellular Location(s) nucl 18, mito 7.5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036736  ACP-like_sf  
IPR018305  Ribosomal_L50_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF10501  Ribosomal_L50  
Amino Acid Sequences MNSTITKQITRQSSGLVRSLHTTRPSLGFMDWFKMKKDQKEVEKKNEIKPRATTEVIKDAEEDKIEVKKVNKIEFIGLKKDPRDELSLGERLNGFHIKHWLNKEKVSSVEKLDEILKNEYQSLKGGKKVKSLDDINLDDLQFRFNYTLKIQEKTGYIIPDYILTKAYSPNILKNYFIKEVFTGRILKKDPEHLSHTELSYKSDNIYIHTPVSDHKADKKYKKLLKKARKDQLLKSEQLIKEADA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.39
4 0.34
5 0.34
6 0.36
7 0.36
8 0.34
9 0.33
10 0.3
11 0.32
12 0.32
13 0.29
14 0.27
15 0.26
16 0.24
17 0.28
18 0.3
19 0.28
20 0.29
21 0.36
22 0.41
23 0.43
24 0.51
25 0.55
26 0.6
27 0.71
28 0.77
29 0.78
30 0.82
31 0.8
32 0.79
33 0.8
34 0.73
35 0.67
36 0.63
37 0.6
38 0.56
39 0.54
40 0.48
41 0.43
42 0.48
43 0.44
44 0.39
45 0.33
46 0.28
47 0.26
48 0.24
49 0.2
50 0.13
51 0.15
52 0.16
53 0.18
54 0.19
55 0.23
56 0.27
57 0.3
58 0.3
59 0.29
60 0.32
61 0.35
62 0.36
63 0.36
64 0.34
65 0.34
66 0.33
67 0.34
68 0.31
69 0.28
70 0.29
71 0.24
72 0.24
73 0.25
74 0.27
75 0.24
76 0.24
77 0.22
78 0.18
79 0.2
80 0.2
81 0.15
82 0.14
83 0.2
84 0.2
85 0.25
86 0.31
87 0.36
88 0.35
89 0.37
90 0.38
91 0.34
92 0.36
93 0.35
94 0.3
95 0.24
96 0.24
97 0.21
98 0.2
99 0.21
100 0.18
101 0.18
102 0.18
103 0.17
104 0.15
105 0.16
106 0.16
107 0.14
108 0.14
109 0.16
110 0.14
111 0.19
112 0.25
113 0.26
114 0.31
115 0.33
116 0.33
117 0.35
118 0.36
119 0.33
120 0.32
121 0.31
122 0.28
123 0.26
124 0.24
125 0.19
126 0.17
127 0.15
128 0.1
129 0.1
130 0.09
131 0.08
132 0.11
133 0.1
134 0.2
135 0.21
136 0.23
137 0.23
138 0.24
139 0.24
140 0.25
141 0.27
142 0.19
143 0.17
144 0.15
145 0.15
146 0.15
147 0.15
148 0.13
149 0.11
150 0.11
151 0.11
152 0.12
153 0.13
154 0.16
155 0.16
156 0.21
157 0.25
158 0.26
159 0.27
160 0.28
161 0.32
162 0.31
163 0.3
164 0.25
165 0.22
166 0.24
167 0.24
168 0.23
169 0.24
170 0.22
171 0.28
172 0.29
173 0.31
174 0.31
175 0.38
176 0.4
177 0.39
178 0.44
179 0.4
180 0.43
181 0.42
182 0.4
183 0.37
184 0.32
185 0.31
186 0.29
187 0.26
188 0.22
189 0.24
190 0.23
191 0.21
192 0.24
193 0.22
194 0.21
195 0.2
196 0.2
197 0.18
198 0.24
199 0.24
200 0.24
201 0.3
202 0.38
203 0.47
204 0.55
205 0.63
206 0.67
207 0.72
208 0.8
209 0.82
210 0.84
211 0.86
212 0.89
213 0.9
214 0.9
215 0.92
216 0.88
217 0.86
218 0.86
219 0.83
220 0.74
221 0.68
222 0.67
223 0.57
224 0.54