Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K0KCR3

Protein Details
Accession K0KCR3    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
143-168KKTLNSRRNFCKSKKKIESDKTQLYEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MLMKLHLMPLVIQNDVEVEEPLAFNANPLVIQNDVEVEEPLAFDVNPLVIQNDDEVEEPLAFDVNPGAIQNDVEVEEPLAFNVNPLVVQHVDEILPPENHPLVAPPVIERLPPNGNDSPLSREERMAEKIFKDHKDYFENEIKKTLNSRRNFCKSKKKIESDKTQLYERLSKAKLHLYEEDFVTIDREATRYSLKDDKIKALYETLSNNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.15
4 0.1
5 0.08
6 0.09
7 0.09
8 0.09
9 0.11
10 0.09
11 0.09
12 0.09
13 0.08
14 0.08
15 0.08
16 0.1
17 0.08
18 0.09
19 0.09
20 0.09
21 0.1
22 0.11
23 0.11
24 0.1
25 0.09
26 0.08
27 0.08
28 0.08
29 0.07
30 0.06
31 0.06
32 0.05
33 0.05
34 0.06
35 0.06
36 0.06
37 0.06
38 0.07
39 0.07
40 0.07
41 0.08
42 0.08
43 0.09
44 0.08
45 0.08
46 0.07
47 0.07
48 0.06
49 0.05
50 0.05
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.06
60 0.06
61 0.06
62 0.07
63 0.07
64 0.07
65 0.07
66 0.08
67 0.07
68 0.06
69 0.06
70 0.05
71 0.05
72 0.05
73 0.07
74 0.06
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.09
81 0.09
82 0.09
83 0.09
84 0.1
85 0.1
86 0.1
87 0.1
88 0.09
89 0.08
90 0.09
91 0.08
92 0.07
93 0.09
94 0.09
95 0.1
96 0.1
97 0.11
98 0.13
99 0.14
100 0.18
101 0.17
102 0.18
103 0.19
104 0.2
105 0.21
106 0.22
107 0.25
108 0.2
109 0.2
110 0.21
111 0.23
112 0.26
113 0.25
114 0.23
115 0.2
116 0.26
117 0.31
118 0.31
119 0.34
120 0.32
121 0.34
122 0.36
123 0.38
124 0.39
125 0.42
126 0.43
127 0.37
128 0.38
129 0.35
130 0.32
131 0.36
132 0.39
133 0.39
134 0.42
135 0.48
136 0.54
137 0.63
138 0.69
139 0.7
140 0.73
141 0.73
142 0.78
143 0.81
144 0.81
145 0.82
146 0.84
147 0.86
148 0.84
149 0.84
150 0.76
151 0.7
152 0.63
153 0.57
154 0.55
155 0.46
156 0.46
157 0.38
158 0.37
159 0.37
160 0.41
161 0.4
162 0.38
163 0.42
164 0.37
165 0.38
166 0.37
167 0.35
168 0.28
169 0.25
170 0.22
171 0.16
172 0.13
173 0.11
174 0.11
175 0.1
176 0.13
177 0.17
178 0.16
179 0.22
180 0.28
181 0.32
182 0.39
183 0.42
184 0.47
185 0.47
186 0.48
187 0.44
188 0.4
189 0.38
190 0.34