Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KV74

Protein Details
Accession K0KV74   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
106-125ENLTKKQKRHLGKSNSKYILHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MSAVSVLDEFLDDYIDEDEEIERLSHIKDPSAAEPAKNHVGVNADHASNKTQLGNTIISQNLSIFQQSHQHNLLYLRNELRIANLQNYCDPNNDKLLSELNNTNFENLTKKQKRHLGKSNSKYILNFTKLEEKKSSNFGLQWHLAHRELILGDWERIKFLARG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.08
5 0.08
6 0.07
7 0.08
8 0.07
9 0.07
10 0.07
11 0.09
12 0.13
13 0.14
14 0.15
15 0.18
16 0.21
17 0.22
18 0.29
19 0.28
20 0.24
21 0.26
22 0.29
23 0.3
24 0.28
25 0.25
26 0.19
27 0.21
28 0.2
29 0.24
30 0.21
31 0.18
32 0.18
33 0.19
34 0.19
35 0.18
36 0.18
37 0.14
38 0.12
39 0.13
40 0.15
41 0.16
42 0.14
43 0.16
44 0.15
45 0.14
46 0.14
47 0.13
48 0.11
49 0.09
50 0.09
51 0.07
52 0.08
53 0.15
54 0.15
55 0.19
56 0.19
57 0.19
58 0.2
59 0.22
60 0.24
61 0.19
62 0.2
63 0.17
64 0.17
65 0.17
66 0.16
67 0.15
68 0.15
69 0.14
70 0.17
71 0.17
72 0.17
73 0.19
74 0.21
75 0.2
76 0.2
77 0.2
78 0.17
79 0.21
80 0.21
81 0.18
82 0.17
83 0.19
84 0.17
85 0.18
86 0.2
87 0.17
88 0.21
89 0.21
90 0.21
91 0.19
92 0.18
93 0.2
94 0.19
95 0.29
96 0.32
97 0.34
98 0.41
99 0.49
100 0.56
101 0.61
102 0.68
103 0.68
104 0.72
105 0.78
106 0.8
107 0.76
108 0.7
109 0.61
110 0.56
111 0.53
112 0.46
113 0.39
114 0.32
115 0.39
116 0.38
117 0.43
118 0.42
119 0.38
120 0.38
121 0.42
122 0.42
123 0.35
124 0.36
125 0.33
126 0.35
127 0.34
128 0.33
129 0.32
130 0.33
131 0.3
132 0.29
133 0.26
134 0.22
135 0.19
136 0.17
137 0.18
138 0.16
139 0.18
140 0.21
141 0.21
142 0.2
143 0.2