Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KZY7

Protein Details
Accession K0KZY7    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
136-156NGDSRNPSRPRRQAKPTVEDLHydrophilic
NLS Segment(s)
PositionSequence
80-109GPRGSRDDRDSRGSRGRDVRGPRRDTRPKK
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003723  F:RNA binding  
GO:0051028  P:mRNA transport  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
Amino Acid Sequences MSNELERSLDELIHGGDEGSSRTKKFQRTSRSTGVAYVGYLDLENNKVAVEKFDGKKAVGERISVEEIRPLNILSIAPRGPRGSRDDRDSRGSRGRDVRGPRRDTRPKKPTLEDLDAELSSYMNGEELPKKEEHTNGDSRNPSRPRRQAKPTVEDLDKELDSYMNNKPFPATGSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.07
4 0.07
5 0.09
6 0.14
7 0.16
8 0.16
9 0.23
10 0.29
11 0.37
12 0.45
13 0.52
14 0.58
15 0.64
16 0.71
17 0.73
18 0.72
19 0.64
20 0.57
21 0.51
22 0.4
23 0.31
24 0.24
25 0.16
26 0.11
27 0.1
28 0.09
29 0.08
30 0.08
31 0.08
32 0.07
33 0.07
34 0.08
35 0.08
36 0.1
37 0.12
38 0.19
39 0.2
40 0.24
41 0.25
42 0.24
43 0.28
44 0.28
45 0.3
46 0.24
47 0.23
48 0.21
49 0.23
50 0.25
51 0.22
52 0.2
53 0.18
54 0.17
55 0.17
56 0.16
57 0.13
58 0.1
59 0.1
60 0.1
61 0.07
62 0.1
63 0.09
64 0.1
65 0.11
66 0.12
67 0.12
68 0.15
69 0.2
70 0.25
71 0.27
72 0.33
73 0.37
74 0.38
75 0.45
76 0.44
77 0.41
78 0.41
79 0.39
80 0.38
81 0.39
82 0.39
83 0.38
84 0.44
85 0.49
86 0.51
87 0.56
88 0.56
89 0.61
90 0.69
91 0.71
92 0.74
93 0.73
94 0.72
95 0.72
96 0.71
97 0.7
98 0.67
99 0.64
100 0.53
101 0.47
102 0.42
103 0.35
104 0.32
105 0.23
106 0.15
107 0.1
108 0.09
109 0.06
110 0.04
111 0.04
112 0.06
113 0.1
114 0.12
115 0.15
116 0.16
117 0.19
118 0.21
119 0.25
120 0.28
121 0.3
122 0.37
123 0.37
124 0.44
125 0.47
126 0.46
127 0.52
128 0.55
129 0.56
130 0.58
131 0.65
132 0.67
133 0.7
134 0.78
135 0.79
136 0.81
137 0.8
138 0.78
139 0.76
140 0.69
141 0.61
142 0.54
143 0.48
144 0.39
145 0.32
146 0.25
147 0.18
148 0.17
149 0.19
150 0.24
151 0.26
152 0.27
153 0.26
154 0.27
155 0.28