Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K0KXT3

Protein Details
Accession K0KXT3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
35-69IAKTPKNFKIKHKTFKDFNKDKSKKKLVQSFKEFPHydrophilic
NLS Segment(s)
PositionSequence
40-60KNFKIKHKTFKDFNKDKSKKK
Subcellular Location(s) mito 13, nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MFFKKSGYRININVKSYENPKIFGRLRREPNNLLIAKTPKNFKIKHKTFKDFNKDKSKKKLVQSFKEFPNPIRELSLNYKLIEIKWERDFYKYKVYGPERYIEYSTCRCLFFSTPGYNNLQYSLIELFSNLTENFQRGIPAFLNTECFGNGLDMIEDHKVLMKIIHEEKNSQIPLKIIFESLLTYILSEEYESLILNDNLYDHKVKAYEFNYQNQLKIMTIWGEKLTSRNEKVMLEQLNYMISNDVLSEPPKNSTMTLIPGYLNYNVSKRNDKLPPSYGLSIMKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.52
3 0.51
4 0.52
5 0.43
6 0.38
7 0.37
8 0.43
9 0.46
10 0.49
11 0.53
12 0.54
13 0.61
14 0.68
15 0.73
16 0.68
17 0.68
18 0.69
19 0.62
20 0.54
21 0.5
22 0.47
23 0.46
24 0.46
25 0.46
26 0.44
27 0.51
28 0.55
29 0.59
30 0.64
31 0.68
32 0.74
33 0.78
34 0.8
35 0.8
36 0.85
37 0.86
38 0.83
39 0.82
40 0.83
41 0.82
42 0.82
43 0.84
44 0.84
45 0.8
46 0.81
47 0.82
48 0.8
49 0.82
50 0.83
51 0.8
52 0.76
53 0.77
54 0.69
55 0.61
56 0.6
57 0.52
58 0.43
59 0.39
60 0.33
61 0.29
62 0.35
63 0.39
64 0.32
65 0.31
66 0.31
67 0.29
68 0.28
69 0.3
70 0.26
71 0.23
72 0.26
73 0.29
74 0.28
75 0.33
76 0.37
77 0.33
78 0.41
79 0.38
80 0.36
81 0.42
82 0.45
83 0.46
84 0.44
85 0.46
86 0.38
87 0.39
88 0.37
89 0.29
90 0.3
91 0.26
92 0.28
93 0.25
94 0.23
95 0.2
96 0.21
97 0.22
98 0.21
99 0.24
100 0.24
101 0.24
102 0.26
103 0.29
104 0.28
105 0.26
106 0.23
107 0.19
108 0.14
109 0.14
110 0.12
111 0.09
112 0.08
113 0.08
114 0.07
115 0.07
116 0.08
117 0.07
118 0.07
119 0.07
120 0.08
121 0.09
122 0.08
123 0.09
124 0.08
125 0.1
126 0.09
127 0.1
128 0.1
129 0.1
130 0.12
131 0.11
132 0.11
133 0.09
134 0.09
135 0.08
136 0.07
137 0.07
138 0.05
139 0.04
140 0.04
141 0.05
142 0.05
143 0.05
144 0.05
145 0.07
146 0.07
147 0.07
148 0.07
149 0.07
150 0.11
151 0.16
152 0.21
153 0.2
154 0.22
155 0.23
156 0.29
157 0.29
158 0.25
159 0.21
160 0.17
161 0.19
162 0.2
163 0.18
164 0.12
165 0.12
166 0.11
167 0.11
168 0.11
169 0.1
170 0.07
171 0.07
172 0.06
173 0.06
174 0.06
175 0.05
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.08
182 0.08
183 0.08
184 0.07
185 0.07
186 0.08
187 0.1
188 0.11
189 0.09
190 0.11
191 0.12
192 0.12
193 0.18
194 0.2
195 0.27
196 0.29
197 0.33
198 0.4
199 0.4
200 0.4
201 0.35
202 0.34
203 0.24
204 0.22
205 0.19
206 0.14
207 0.14
208 0.15
209 0.14
210 0.14
211 0.15
212 0.18
213 0.23
214 0.27
215 0.29
216 0.3
217 0.32
218 0.31
219 0.34
220 0.37
221 0.34
222 0.28
223 0.27
224 0.24
225 0.24
226 0.23
227 0.2
228 0.14
229 0.1
230 0.09
231 0.09
232 0.09
233 0.09
234 0.11
235 0.13
236 0.14
237 0.17
238 0.18
239 0.19
240 0.18
241 0.2
242 0.21
243 0.23
244 0.24
245 0.22
246 0.21
247 0.21
248 0.23
249 0.22
250 0.22
251 0.19
252 0.21
253 0.25
254 0.3
255 0.36
256 0.36
257 0.44
258 0.49
259 0.53
260 0.57
261 0.56
262 0.57
263 0.56
264 0.56
265 0.5