Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K0KGZ4

Protein Details
Accession K0KGZ4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-44QETTKKVSKAPKKKFEVRKWTAHydrophilic
NLS Segment(s)
PositionSequence
31-36KAPKKK
Subcellular Location(s) nucl 15, cyto_nucl 12.833, cyto 9.5, mito_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013083  Znf_RING/FYVE/PHD  
IPR024766  Znf_RING_H2  
Gene Ontology GO:0008270  F:zinc ion binding  
GO:0016567  P:protein ubiquitination  
Pfam View protein in Pfam  
PF12678  zf-rbx1  
Amino Acid Sequences MSDAMEVDVPPGETEEQKEQTEQETTKKVSKAPKKKFEVRKWTAVAFWSWDIVVETCAICRNHLMEPCIECQPNSMSATSNECIAAWGTCNVSITV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.2
3 0.23
4 0.24
5 0.24
6 0.23
7 0.24
8 0.28
9 0.26
10 0.25
11 0.27
12 0.29
13 0.33
14 0.34
15 0.36
16 0.41
17 0.5
18 0.55
19 0.6
20 0.67
21 0.7
22 0.78
23 0.85
24 0.85
25 0.85
26 0.8
27 0.77
28 0.69
29 0.62
30 0.53
31 0.43
32 0.34
33 0.25
34 0.2
35 0.12
36 0.09
37 0.09
38 0.08
39 0.07
40 0.07
41 0.06
42 0.05
43 0.05
44 0.1
45 0.1
46 0.1
47 0.1
48 0.12
49 0.15
50 0.18
51 0.2
52 0.18
53 0.2
54 0.23
55 0.26
56 0.24
57 0.2
58 0.2
59 0.21
60 0.21
61 0.21
62 0.19
63 0.16
64 0.18
65 0.23
66 0.21
67 0.2
68 0.17
69 0.15
70 0.16
71 0.15
72 0.14
73 0.1
74 0.12
75 0.12
76 0.13