Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S051

Protein Details
Accession E3S051    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
34-53LKPTPCKIAKRKAYEAKRAPHydrophilic
NLS Segment(s)
PositionSequence
159-170GTGGKKKKKGKK
Subcellular Location(s) mito 13, nucl 10, cyto_nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG pte:PTT_15398  -  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MPYFTTSAEWLEQSSLLLKARPSSTRITSKYTVLKPTPCKIAKRKAYEAKRAPSPADTTRTSSPPPPQPQDVDEVTVTFTLKTYDPASGTSLKYETNKGAEVGRLIGNLGRLGRHMAALPELAEESAGGEGASASAPQADESGHVKMGGVPADPKAGTGTGGKKKKKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.15
5 0.15
6 0.18
7 0.22
8 0.24
9 0.26
10 0.29
11 0.36
12 0.43
13 0.45
14 0.48
15 0.46
16 0.49
17 0.54
18 0.53
19 0.53
20 0.48
21 0.53
22 0.52
23 0.54
24 0.58
25 0.55
26 0.59
27 0.6
28 0.66
29 0.67
30 0.69
31 0.74
32 0.74
33 0.78
34 0.8
35 0.79
36 0.75
37 0.72
38 0.66
39 0.58
40 0.5
41 0.47
42 0.41
43 0.38
44 0.34
45 0.32
46 0.33
47 0.34
48 0.33
49 0.32
50 0.33
51 0.37
52 0.42
53 0.41
54 0.41
55 0.4
56 0.4
57 0.4
58 0.35
59 0.28
60 0.21
61 0.17
62 0.15
63 0.14
64 0.12
65 0.07
66 0.07
67 0.06
68 0.06
69 0.08
70 0.08
71 0.09
72 0.09
73 0.1
74 0.13
75 0.14
76 0.14
77 0.13
78 0.13
79 0.13
80 0.14
81 0.15
82 0.14
83 0.13
84 0.14
85 0.13
86 0.14
87 0.13
88 0.12
89 0.12
90 0.11
91 0.09
92 0.09
93 0.09
94 0.08
95 0.09
96 0.09
97 0.07
98 0.07
99 0.09
100 0.09
101 0.09
102 0.09
103 0.09
104 0.09
105 0.09
106 0.09
107 0.08
108 0.07
109 0.07
110 0.06
111 0.05
112 0.05
113 0.05
114 0.04
115 0.04
116 0.03
117 0.03
118 0.04
119 0.04
120 0.03
121 0.03
122 0.04
123 0.04
124 0.05
125 0.05
126 0.05
127 0.07
128 0.1
129 0.12
130 0.12
131 0.12
132 0.12
133 0.13
134 0.15
135 0.14
136 0.13
137 0.12
138 0.13
139 0.17
140 0.16
141 0.15
142 0.15
143 0.14
144 0.14
145 0.18
146 0.26
147 0.32
148 0.42
149 0.47
150 0.53