Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6RFS0

Protein Details
Accession A6RFS0   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
23-42LEKEKGKGKGRKKRVQESKEBasic
NLS Segment(s)
PositionSequence
23-38LEKEKGKGKGRKKRVQ
Subcellular Location(s) mito 11.5, cyto_mito 9.5, nucl 9, cyto 6.5
Family & Domain DBs
KEGG aje:HCAG_08486  -  
Amino Acid Sequences MGRRQAVAGELMSATIERGTNRLEKEKGKGKGRKKRVQESKEQWKQVNKYHIIGKRTRGEILRMKEELAGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.08
4 0.07
5 0.08
6 0.11
7 0.15
8 0.18
9 0.24
10 0.27
11 0.28
12 0.35
13 0.42
14 0.47
15 0.52
16 0.57
17 0.62
18 0.68
19 0.76
20 0.77
21 0.76
22 0.79
23 0.8
24 0.77
25 0.78
26 0.77
27 0.78
28 0.78
29 0.74
30 0.68
31 0.65
32 0.64
33 0.61
34 0.61
35 0.52
36 0.48
37 0.51
38 0.53
39 0.51
40 0.51
41 0.51
42 0.49
43 0.48
44 0.49
45 0.44
46 0.45
47 0.48
48 0.51
49 0.5
50 0.44
51 0.42