Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6QU12

Protein Details
Accession A6QU12    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
27-64SHLNSQDRRKPKPQQFKGTNKPKPKKRLNNRGHPQSHDHydrophilic
NLS Segment(s)
PositionSequence
20-57DRRGGRGSHLNSQDRRKPKPQQFKGTNKPKPKKRLNNR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, mito 3
Family & Domain DBs
KEGG aje:HCAG_00868  -  
Amino Acid Sequences MEGPNRKPGQQEGRRNVPFDRRGGRGSHLNSQDRRKPKPQQFKGTNKPKPKKRLNNRGHPQSHDNAGIRNHKASDNKFGLDGNADLDPTNYPNEHQCSQDNADIQKLQQHEPHIRHGQSEAEHTSRKRSRQDESPERPEEPRRQEDDITPKLKRRQPHVAEAYSRRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.71
3 0.67
4 0.65
5 0.61
6 0.57
7 0.54
8 0.47
9 0.47
10 0.47
11 0.47
12 0.45
13 0.44
14 0.46
15 0.48
16 0.52
17 0.55
18 0.61
19 0.65
20 0.64
21 0.67
22 0.67
23 0.7
24 0.73
25 0.79
26 0.8
27 0.82
28 0.85
29 0.88
30 0.9
31 0.9
32 0.89
33 0.88
34 0.88
35 0.87
36 0.87
37 0.87
38 0.88
39 0.88
40 0.9
41 0.89
42 0.9
43 0.9
44 0.9
45 0.83
46 0.77
47 0.7
48 0.62
49 0.55
50 0.48
51 0.39
52 0.32
53 0.32
54 0.33
55 0.3
56 0.28
57 0.26
58 0.25
59 0.29
60 0.29
61 0.32
62 0.29
63 0.28
64 0.27
65 0.26
66 0.22
67 0.18
68 0.16
69 0.09
70 0.07
71 0.07
72 0.06
73 0.07
74 0.07
75 0.07
76 0.08
77 0.06
78 0.07
79 0.11
80 0.15
81 0.16
82 0.18
83 0.18
84 0.21
85 0.24
86 0.26
87 0.25
88 0.21
89 0.22
90 0.21
91 0.19
92 0.19
93 0.18
94 0.17
95 0.18
96 0.22
97 0.27
98 0.29
99 0.37
100 0.4
101 0.38
102 0.37
103 0.36
104 0.34
105 0.28
106 0.3
107 0.26
108 0.23
109 0.27
110 0.27
111 0.35
112 0.37
113 0.42
114 0.47
115 0.48
116 0.5
117 0.56
118 0.66
119 0.67
120 0.71
121 0.74
122 0.69
123 0.67
124 0.65
125 0.64
126 0.62
127 0.6
128 0.59
129 0.56
130 0.56
131 0.56
132 0.59
133 0.61
134 0.6
135 0.57
136 0.53
137 0.55
138 0.6
139 0.62
140 0.61
141 0.6
142 0.63
143 0.63
144 0.7
145 0.71
146 0.69
147 0.73