Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A6RBV1

Protein Details
Accession A6RBV1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
39-59ETSSSSTRRQKPPSSKRPFTTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008218  ATPase_V1-cplx_f_g_su  
IPR036906  ATPase_V1_fsu_sf  
Gene Ontology GO:0005774  C:vacuolar membrane  
GO:0046961  F:proton-transporting ATPase activity, rotational mechanism  
KEGG aje:HCAG_07109  -  
Pfam View protein in Pfam  
PF01990  ATP-synt_F  
Amino Acid Sequences MAAPAGTYKDRQFLAVIGDEDSVTGLLLAGIGIHQTHNETSSSSTRRQKPPSSKRPFTTSRRYARISECY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.19
4 0.15
5 0.15
6 0.14
7 0.13
8 0.12
9 0.09
10 0.05
11 0.04
12 0.03
13 0.03
14 0.03
15 0.03
16 0.02
17 0.02
18 0.02
19 0.03
20 0.03
21 0.03
22 0.04
23 0.04
24 0.06
25 0.06
26 0.07
27 0.09
28 0.15
29 0.19
30 0.25
31 0.33
32 0.4
33 0.48
34 0.55
35 0.61
36 0.67
37 0.75
38 0.79
39 0.82
40 0.82
41 0.78
42 0.79
43 0.78
44 0.75
45 0.75
46 0.74
47 0.73
48 0.72
49 0.71
50 0.68