Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6QY48

Protein Details
Accession A6QY48   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
143-172DEGEKEAARQKRKKIKIKQKKQNRDAIDDIBasic
NLS Segment(s)
PositionSequence
94-110QRKKESDSGQKEKIERK
149-164AARQKRKKIKIKQKKQ
Subcellular Location(s) nucl 7.5, cyto_nucl 7.333, mito_nucl 6.166, cyto 5, extr 5, mito 3.5, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR047205  RMP1  
Gene Ontology GO:0000172  C:ribonuclease MRP complex  
GO:0042134  F:rRNA primary transcript binding  
KEGG aje:HCAG_02305  -  
Amino Acid Sequences MQFSALGVVLLAVLAQAAKAVAHIEEFHLLAMGSNTSTDNNSMSAIATTATAVPAVSINCSEDVGVDVGEVVNRLLHVPELTADPAAFEEKEKQRKKESDSGQKEKIERKRSPFVSDAIRERQKLGMTEKSRWESSLTQLDEDEGEKEAARQKRKKIKIKQKKQNRDAIDDIFGRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.03
4 0.03
5 0.03
6 0.04
7 0.05
8 0.05
9 0.06
10 0.07
11 0.08
12 0.1
13 0.1
14 0.1
15 0.09
16 0.09
17 0.08
18 0.08
19 0.07
20 0.06
21 0.06
22 0.07
23 0.07
24 0.08
25 0.09
26 0.09
27 0.09
28 0.1
29 0.09
30 0.09
31 0.08
32 0.08
33 0.07
34 0.06
35 0.06
36 0.05
37 0.05
38 0.05
39 0.04
40 0.05
41 0.06
42 0.06
43 0.06
44 0.06
45 0.07
46 0.07
47 0.08
48 0.07
49 0.06
50 0.07
51 0.07
52 0.06
53 0.05
54 0.04
55 0.04
56 0.04
57 0.04
58 0.03
59 0.03
60 0.03
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.05
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.07
74 0.06
75 0.05
76 0.12
77 0.18
78 0.28
79 0.32
80 0.35
81 0.42
82 0.46
83 0.52
84 0.55
85 0.58
86 0.59
87 0.64
88 0.68
89 0.66
90 0.64
91 0.62
92 0.61
93 0.61
94 0.58
95 0.54
96 0.55
97 0.58
98 0.58
99 0.59
100 0.53
101 0.47
102 0.45
103 0.44
104 0.42
105 0.42
106 0.43
107 0.39
108 0.38
109 0.38
110 0.33
111 0.32
112 0.32
113 0.34
114 0.33
115 0.37
116 0.43
117 0.44
118 0.43
119 0.4
120 0.39
121 0.31
122 0.33
123 0.37
124 0.32
125 0.28
126 0.28
127 0.27
128 0.24
129 0.23
130 0.18
131 0.11
132 0.1
133 0.09
134 0.11
135 0.18
136 0.25
137 0.34
138 0.4
139 0.48
140 0.59
141 0.69
142 0.78
143 0.82
144 0.86
145 0.88
146 0.93
147 0.93
148 0.94
149 0.95
150 0.94
151 0.92
152 0.87
153 0.83
154 0.78
155 0.71
156 0.65