Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S7W7

Protein Details
Accession E3S7W7    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
44-68ARPVLRVPKMRKARKASKLFKPLPIHydrophilic
NLS Segment(s)
PositionSequence
50-61VPKMRKARKASK
Subcellular Location(s) mito 14.5, cyto_mito 10, nucl 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016939  Mt__Rbsml_prot_S25  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG pte:PTT_18967  -  
Pfam View protein in Pfam  
PF13741  MRP-S25  
Amino Acid Sequences MGRYDFRPLRVRQTAKALFDAKRDPVLPQWYDVVGNIPPGETLARPVLRVPKMRKARKASKLFKPLPIVYPEDKLRSEFFGEHPWELARPRLVVENSGNDAKNYDWSKIEQPGKQLDGESVVQRQLWLMKHASLSKASAYDLARREFYKHRHLSEIRQRIAKEEAQHVGAYFGKGPLEIGMELEDRMWENWKSWATKQIDDEQAMRAQMFSGQQNEGLGAGAEMTNSEYDTAVEELQPAVPNNPQGQRPMGGVVAHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.58
3 0.61
4 0.57
5 0.49
6 0.5
7 0.5
8 0.43
9 0.41
10 0.38
11 0.34
12 0.35
13 0.4
14 0.36
15 0.33
16 0.32
17 0.29
18 0.28
19 0.27
20 0.22
21 0.15
22 0.16
23 0.14
24 0.11
25 0.1
26 0.11
27 0.12
28 0.09
29 0.12
30 0.16
31 0.17
32 0.17
33 0.2
34 0.28
35 0.32
36 0.41
37 0.44
38 0.47
39 0.58
40 0.66
41 0.72
42 0.73
43 0.78
44 0.8
45 0.85
46 0.83
47 0.83
48 0.85
49 0.8
50 0.76
51 0.73
52 0.65
53 0.58
54 0.53
55 0.48
56 0.39
57 0.4
58 0.36
59 0.33
60 0.31
61 0.29
62 0.27
63 0.24
64 0.24
65 0.21
66 0.2
67 0.24
68 0.25
69 0.23
70 0.23
71 0.21
72 0.2
73 0.19
74 0.2
75 0.14
76 0.12
77 0.13
78 0.17
79 0.17
80 0.19
81 0.2
82 0.2
83 0.21
84 0.24
85 0.23
86 0.18
87 0.18
88 0.15
89 0.2
90 0.18
91 0.17
92 0.16
93 0.18
94 0.21
95 0.28
96 0.32
97 0.27
98 0.29
99 0.31
100 0.31
101 0.29
102 0.26
103 0.19
104 0.17
105 0.16
106 0.14
107 0.12
108 0.11
109 0.1
110 0.1
111 0.1
112 0.11
113 0.1
114 0.11
115 0.11
116 0.12
117 0.14
118 0.15
119 0.16
120 0.14
121 0.14
122 0.12
123 0.12
124 0.11
125 0.13
126 0.13
127 0.17
128 0.19
129 0.2
130 0.21
131 0.21
132 0.24
133 0.27
134 0.31
135 0.36
136 0.38
137 0.39
138 0.45
139 0.47
140 0.52
141 0.57
142 0.6
143 0.53
144 0.52
145 0.5
146 0.45
147 0.47
148 0.4
149 0.33
150 0.28
151 0.27
152 0.24
153 0.24
154 0.21
155 0.19
156 0.17
157 0.14
158 0.11
159 0.09
160 0.08
161 0.08
162 0.08
163 0.07
164 0.08
165 0.07
166 0.07
167 0.08
168 0.08
169 0.08
170 0.08
171 0.08
172 0.07
173 0.08
174 0.11
175 0.1
176 0.11
177 0.16
178 0.2
179 0.23
180 0.24
181 0.32
182 0.32
183 0.36
184 0.39
185 0.42
186 0.43
187 0.41
188 0.41
189 0.35
190 0.33
191 0.29
192 0.25
193 0.17
194 0.13
195 0.13
196 0.15
197 0.15
198 0.16
199 0.16
200 0.17
201 0.17
202 0.17
203 0.15
204 0.12
205 0.09
206 0.06
207 0.06
208 0.05
209 0.05
210 0.05
211 0.06
212 0.06
213 0.06
214 0.07
215 0.06
216 0.07
217 0.09
218 0.1
219 0.1
220 0.1
221 0.1
222 0.1
223 0.12
224 0.14
225 0.13
226 0.14
227 0.16
228 0.2
229 0.25
230 0.29
231 0.3
232 0.31
233 0.33
234 0.33
235 0.32
236 0.31
237 0.27