Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A6R7S5

Protein Details
Accession A6R7S5    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
13-32SIPASTSKAKPKPERLPITVHydrophilic
NLS Segment(s)
PositionSequence
121-149ELFARKKGIGKYNKKLGSGGGSAEAERRK
Subcellular Location(s) cyto 12, cyto_mito 10.333, cyto_nucl 7.833, mito 7.5, nucl 2.5, pero 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0016020  C:membrane  
GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
KEGG aje:HCAG_06366  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MAIADMVGSTSTSIPASTSKAKPKPERLPITVEKPTPYTFDLGHLLALDPNPLILSNDTSLNAALTATARDGAQSLLNQLLTTCTITSTTRDGILLSLPPRTTLLPRFKPLPAPKQPTKWELFARKKGIGKYNKKLGSGGGSAEAERRKKLVYDEASGEWVPRWGYKGKNKGGENDWLVEVDEKVWKKEEGLSLDVESTVAFQSYLQGSLAFLMLCCVYVRLVLAKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.15
4 0.22
5 0.28
6 0.37
7 0.44
8 0.53
9 0.62
10 0.7
11 0.75
12 0.78
13 0.8
14 0.74
15 0.76
16 0.72
17 0.71
18 0.67
19 0.59
20 0.51
21 0.46
22 0.43
23 0.38
24 0.33
25 0.27
26 0.21
27 0.22
28 0.23
29 0.2
30 0.19
31 0.16
32 0.15
33 0.13
34 0.13
35 0.1
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.09
43 0.1
44 0.11
45 0.11
46 0.12
47 0.12
48 0.1
49 0.09
50 0.07
51 0.06
52 0.05
53 0.05
54 0.05
55 0.06
56 0.05
57 0.06
58 0.06
59 0.07
60 0.08
61 0.07
62 0.08
63 0.09
64 0.09
65 0.09
66 0.08
67 0.08
68 0.08
69 0.08
70 0.07
71 0.06
72 0.08
73 0.08
74 0.1
75 0.12
76 0.12
77 0.11
78 0.12
79 0.11
80 0.1
81 0.1
82 0.11
83 0.09
84 0.1
85 0.1
86 0.1
87 0.11
88 0.12
89 0.14
90 0.19
91 0.27
92 0.29
93 0.31
94 0.33
95 0.33
96 0.41
97 0.43
98 0.46
99 0.45
100 0.49
101 0.51
102 0.55
103 0.58
104 0.55
105 0.52
106 0.46
107 0.44
108 0.47
109 0.5
110 0.51
111 0.51
112 0.51
113 0.52
114 0.52
115 0.54
116 0.54
117 0.55
118 0.55
119 0.6
120 0.59
121 0.56
122 0.53
123 0.45
124 0.39
125 0.31
126 0.24
127 0.17
128 0.14
129 0.13
130 0.17
131 0.2
132 0.17
133 0.17
134 0.17
135 0.16
136 0.17
137 0.2
138 0.26
139 0.25
140 0.27
141 0.3
142 0.3
143 0.32
144 0.3
145 0.27
146 0.19
147 0.16
148 0.13
149 0.11
150 0.13
151 0.14
152 0.22
153 0.31
154 0.4
155 0.45
156 0.53
157 0.54
158 0.57
159 0.56
160 0.56
161 0.5
162 0.42
163 0.36
164 0.28
165 0.27
166 0.22
167 0.19
168 0.13
169 0.16
170 0.15
171 0.16
172 0.19
173 0.18
174 0.19
175 0.24
176 0.28
177 0.27
178 0.28
179 0.28
180 0.27
181 0.27
182 0.25
183 0.2
184 0.14
185 0.1
186 0.09
187 0.07
188 0.06
189 0.05
190 0.09
191 0.1
192 0.11
193 0.11
194 0.1
195 0.1
196 0.11
197 0.12
198 0.08
199 0.07
200 0.08
201 0.07
202 0.08
203 0.08
204 0.08
205 0.07
206 0.08
207 0.1