Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6R501

Protein Details
Accession A6R501   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
103-129LVYGNKRLSGKKRKARRAGNGARKEIVHydrophilic
NLS Segment(s)
PositionSequence
108-126KRLSGKKRKARRAGNGARK
Subcellular Location(s) extr 14, mito 8, cyto 1, plas 1, pero 1, E.R. 1, golg 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG aje:HCAG_04709  -  
Amino Acid Sequences MWPTLTLFCHPQLASIPNNVKKYSSQVADSVNEHVDHLAVTVRDVLARQSWLPSVVKPLGKPVAKSPSSFPPRSTLDLIQDWISRNRAWTAAIVAFVGTGAFLVYGNKRLSGKKRKARRAGNGARKEIVGSQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.38
4 0.39
5 0.43
6 0.42
7 0.4
8 0.37
9 0.42
10 0.4
11 0.35
12 0.3
13 0.3
14 0.32
15 0.33
16 0.33
17 0.29
18 0.23
19 0.21
20 0.19
21 0.16
22 0.12
23 0.09
24 0.09
25 0.08
26 0.06
27 0.07
28 0.07
29 0.07
30 0.07
31 0.07
32 0.08
33 0.08
34 0.09
35 0.09
36 0.09
37 0.1
38 0.12
39 0.13
40 0.12
41 0.15
42 0.17
43 0.19
44 0.17
45 0.21
46 0.25
47 0.25
48 0.26
49 0.26
50 0.31
51 0.3
52 0.31
53 0.3
54 0.33
55 0.39
56 0.39
57 0.35
58 0.32
59 0.34
60 0.36
61 0.36
62 0.28
63 0.25
64 0.25
65 0.25
66 0.22
67 0.2
68 0.19
69 0.18
70 0.19
71 0.15
72 0.16
73 0.16
74 0.15
75 0.14
76 0.13
77 0.14
78 0.13
79 0.13
80 0.11
81 0.1
82 0.09
83 0.08
84 0.07
85 0.04
86 0.03
87 0.02
88 0.03
89 0.03
90 0.05
91 0.06
92 0.12
93 0.13
94 0.15
95 0.18
96 0.24
97 0.35
98 0.44
99 0.54
100 0.59
101 0.69
102 0.77
103 0.85
104 0.89
105 0.89
106 0.89
107 0.9
108 0.91
109 0.89
110 0.83
111 0.75
112 0.65
113 0.56