Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6RDX4

Protein Details
Accession A6RDX4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
22-41WPIHGGKKLRKRLRGCFQVKBasic
NLS Segment(s)
PositionSequence
31-31R
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, cyto 6.5, pero 4, mito 3
Family & Domain DBs
KEGG aje:HCAG_07832  -  
Amino Acid Sequences MEQELSRYQGLSGRDETTEQTWPIHGGKKLRKRLRGCFQVKRILRDSASGINVQDGDGVRRTNVTDHGHPAAYAAALTLGASGNSSAKRAAIGYMDPLDVTHSCKELRNLAAAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.24
4 0.23
5 0.24
6 0.21
7 0.19
8 0.18
9 0.19
10 0.21
11 0.24
12 0.24
13 0.3
14 0.38
15 0.47
16 0.57
17 0.63
18 0.69
19 0.71
20 0.78
21 0.79
22 0.8
23 0.79
24 0.78
25 0.75
26 0.76
27 0.72
28 0.67
29 0.6
30 0.53
31 0.45
32 0.38
33 0.34
34 0.28
35 0.26
36 0.21
37 0.18
38 0.15
39 0.14
40 0.12
41 0.11
42 0.08
43 0.07
44 0.08
45 0.08
46 0.08
47 0.08
48 0.09
49 0.08
50 0.14
51 0.16
52 0.17
53 0.2
54 0.22
55 0.21
56 0.21
57 0.2
58 0.15
59 0.11
60 0.09
61 0.05
62 0.04
63 0.04
64 0.04
65 0.04
66 0.03
67 0.03
68 0.04
69 0.04
70 0.06
71 0.07
72 0.08
73 0.08
74 0.08
75 0.09
76 0.09
77 0.1
78 0.1
79 0.1
80 0.13
81 0.14
82 0.14
83 0.13
84 0.13
85 0.15
86 0.14
87 0.17
88 0.15
89 0.16
90 0.18
91 0.22
92 0.25
93 0.29
94 0.3