Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6QRY1

Protein Details
Accession A6QRY1    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
57-80GNQRRSDKSSNHRNKRKREEQTGSHydrophilic
NLS Segment(s)
PositionSequence
43-74RRRAIRKGRPAIFVGNQRRSDKSSNHRNKRKR
Subcellular Location(s) nucl 21.5, mito_nucl 13.166, cyto_nucl 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG aje:HCAG_00137  -  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MDNLRSKALKVLRTELDRRNQEPQNYEELLRTLQTLEENMPERRRAIRKGRPAIFVGNQRRSDKSSNHRNKRKREEQTGSTEQTKKDKYNWMKECSHCHKKGHIANDCWMLYPEKRNQVRQAKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.55
3 0.58
4 0.6
5 0.59
6 0.61
7 0.6
8 0.58
9 0.56
10 0.52
11 0.49
12 0.44
13 0.41
14 0.34
15 0.3
16 0.25
17 0.21
18 0.18
19 0.12
20 0.11
21 0.1
22 0.1
23 0.1
24 0.13
25 0.16
26 0.19
27 0.21
28 0.21
29 0.22
30 0.28
31 0.32
32 0.36
33 0.42
34 0.48
35 0.56
36 0.64
37 0.66
38 0.63
39 0.6
40 0.56
41 0.5
42 0.5
43 0.47
44 0.45
45 0.45
46 0.43
47 0.43
48 0.43
49 0.43
50 0.4
51 0.42
52 0.46
53 0.53
54 0.62
55 0.7
56 0.74
57 0.81
58 0.85
59 0.86
60 0.83
61 0.83
62 0.8
63 0.75
64 0.76
65 0.72
66 0.65
67 0.6
68 0.55
69 0.46
70 0.46
71 0.45
72 0.38
73 0.37
74 0.44
75 0.47
76 0.55
77 0.6
78 0.59
79 0.62
80 0.64
81 0.69
82 0.69
83 0.71
84 0.65
85 0.62
86 0.62
87 0.64
88 0.66
89 0.66
90 0.65
91 0.59
92 0.59
93 0.62
94 0.56
95 0.47
96 0.43
97 0.36
98 0.31
99 0.35
100 0.37
101 0.41
102 0.47
103 0.52
104 0.61