Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6R7Y4

Protein Details
Accession A6R7Y4    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-29VAAKKHIPIVKKHKKRFNRHQSDLYKCVHydrophilic
NLS Segment(s)
PositionSequence
7-17HIPIVKKHKKR
Subcellular Location(s) mito 16, cyto 6, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG aje:HCAG_06425  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHIPIVKKHKKRFNRHQSDLYKCVDASWRKPKGIDNRVRRRFSGQAAMPKIGYGSNKKTRHMIPSGHKVFLVQNPKDVELLLMHNRTYAAEIGHAVSSGKRIDIIAKAKQLGVKVTNPKGRLTTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.84
3 0.91
4 0.92
5 0.92
6 0.92
7 0.89
8 0.89
9 0.88
10 0.85
11 0.79
12 0.71
13 0.61
14 0.5
15 0.44
16 0.41
17 0.37
18 0.37
19 0.42
20 0.45
21 0.44
22 0.46
23 0.52
24 0.55
25 0.6
26 0.61
27 0.62
28 0.68
29 0.76
30 0.78
31 0.72
32 0.67
33 0.6
34 0.54
35 0.52
36 0.44
37 0.43
38 0.43
39 0.42
40 0.36
41 0.32
42 0.28
43 0.21
44 0.2
45 0.16
46 0.21
47 0.3
48 0.32
49 0.34
50 0.37
51 0.38
52 0.41
53 0.4
54 0.39
55 0.36
56 0.44
57 0.45
58 0.42
59 0.39
60 0.35
61 0.33
62 0.32
63 0.35
64 0.24
65 0.26
66 0.27
67 0.28
68 0.27
69 0.25
70 0.2
71 0.13
72 0.16
73 0.16
74 0.16
75 0.15
76 0.15
77 0.15
78 0.15
79 0.15
80 0.12
81 0.08
82 0.08
83 0.09
84 0.1
85 0.1
86 0.1
87 0.08
88 0.08
89 0.1
90 0.1
91 0.09
92 0.08
93 0.09
94 0.11
95 0.18
96 0.23
97 0.26
98 0.3
99 0.31
100 0.32
101 0.34
102 0.33
103 0.31
104 0.3
105 0.32
106 0.37
107 0.45
108 0.5
109 0.49
110 0.51
111 0.49