Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6R519

Protein Details
Accession A6R519    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
146-171EMRGSGCGSRRRNKRGRLKEMQRKNVBasic
NLS Segment(s)
PositionSequence
155-169RRRNKRGRLKEMQRK
Subcellular Location(s) cyto_nucl 10.5, nucl 9.5, cyto 8.5, mito 4, pero 3
Family & Domain DBs
KEGG aje:HCAG_04727  -  
Amino Acid Sequences MDRQGTEGPPPLPSQLLSSGAQQSTLPAYCAVLGDFLEKTPFQTYASAPLNVPPERLSVDRASNNRPQPPGGIEPDGRDNISDSGATTEPLAHDELKNLPYWYEAQHVEKSLKICHVGDKVWRNNKYVHRVLYVVETYLPDNCLPEMRGSGCGSRRRNKRGRLKEMQRKNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.22
4 0.21
5 0.23
6 0.26
7 0.25
8 0.25
9 0.21
10 0.19
11 0.19
12 0.19
13 0.16
14 0.12
15 0.12
16 0.12
17 0.12
18 0.11
19 0.08
20 0.08
21 0.09
22 0.09
23 0.09
24 0.1
25 0.1
26 0.12
27 0.13
28 0.13
29 0.12
30 0.14
31 0.15
32 0.21
33 0.24
34 0.23
35 0.21
36 0.24
37 0.28
38 0.26
39 0.26
40 0.19
41 0.17
42 0.19
43 0.19
44 0.2
45 0.17
46 0.21
47 0.26
48 0.28
49 0.31
50 0.36
51 0.4
52 0.41
53 0.39
54 0.35
55 0.31
56 0.32
57 0.31
58 0.27
59 0.25
60 0.21
61 0.22
62 0.24
63 0.23
64 0.19
65 0.15
66 0.14
67 0.11
68 0.11
69 0.09
70 0.07
71 0.08
72 0.09
73 0.09
74 0.07
75 0.07
76 0.07
77 0.08
78 0.09
79 0.07
80 0.07
81 0.09
82 0.11
83 0.11
84 0.12
85 0.11
86 0.1
87 0.1
88 0.11
89 0.12
90 0.13
91 0.14
92 0.17
93 0.18
94 0.2
95 0.2
96 0.21
97 0.21
98 0.19
99 0.19
100 0.18
101 0.17
102 0.2
103 0.21
104 0.21
105 0.27
106 0.34
107 0.41
108 0.48
109 0.5
110 0.47
111 0.52
112 0.58
113 0.6
114 0.57
115 0.52
116 0.45
117 0.43
118 0.42
119 0.4
120 0.32
121 0.24
122 0.19
123 0.17
124 0.15
125 0.15
126 0.16
127 0.11
128 0.11
129 0.11
130 0.13
131 0.13
132 0.14
133 0.16
134 0.15
135 0.19
136 0.2
137 0.25
138 0.3
139 0.38
140 0.44
141 0.51
142 0.59
143 0.66
144 0.74
145 0.79
146 0.83
147 0.86
148 0.88
149 0.9
150 0.91
151 0.91