Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S297

Protein Details
Accession E3S297   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26GKRKSSSKPQGPKKKEKLPTTFQCLFHydrophilic
NLS Segment(s)
PositionSequence
2-17KRKSSSKPQGPKKKEK
Subcellular Location(s) nucl 17, mito 6, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
KEGG pte:PTT_16414  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences GKRKSSSKPQGPKKKEKLPTTFQCLFCNHEKSVSVSIEKKSGVGNLQCKVCGQTFQTNINYLSAPVDVYADWIDACDAVAKEAAKGNAEMSRSSNRMGRMPTAHNQDDDDGDGGFIEHDEADAEGEYAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.88
4 0.85
5 0.84
6 0.82
7 0.8
8 0.78
9 0.7
10 0.65
11 0.57
12 0.53
13 0.5
14 0.46
15 0.38
16 0.33
17 0.31
18 0.31
19 0.34
20 0.31
21 0.28
22 0.27
23 0.28
24 0.28
25 0.26
26 0.23
27 0.19
28 0.19
29 0.19
30 0.21
31 0.24
32 0.25
33 0.25
34 0.25
35 0.25
36 0.25
37 0.21
38 0.18
39 0.17
40 0.2
41 0.22
42 0.26
43 0.27
44 0.27
45 0.27
46 0.25
47 0.22
48 0.15
49 0.13
50 0.09
51 0.08
52 0.06
53 0.06
54 0.05
55 0.06
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.04
62 0.04
63 0.05
64 0.05
65 0.05
66 0.07
67 0.07
68 0.08
69 0.1
70 0.11
71 0.1
72 0.1
73 0.11
74 0.12
75 0.14
76 0.14
77 0.15
78 0.19
79 0.19
80 0.21
81 0.23
82 0.22
83 0.25
84 0.27
85 0.28
86 0.28
87 0.32
88 0.37
89 0.42
90 0.42
91 0.39
92 0.38
93 0.35
94 0.31
95 0.28
96 0.22
97 0.14
98 0.12
99 0.1
100 0.09
101 0.07
102 0.06
103 0.05
104 0.04
105 0.04
106 0.05
107 0.05
108 0.06
109 0.07