Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6QZ47

Protein Details
Accession A6QZ47   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-34LSNVAKFVPKRLRKRLRDNIMGIHydrophilic
NLS Segment(s)
PositionSequence
21-28KRLRKRLR
Subcellular Location(s) mito 17, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
KEGG aje:HCAG_02654  -  
Amino Acid Sequences METINSRHNRNLSNVAKFVPKRLRKRLRDNIMGIAKPTTIRRLARRGGVIRIQKDIYDTVRSVVLERLREIIRRLVNLLEGSKYPNRERKTVTTRDVSCVHIAWHGKFCLRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.45
3 0.49
4 0.46
5 0.49
6 0.49
7 0.52
8 0.56
9 0.65
10 0.74
11 0.75
12 0.85
13 0.88
14 0.86
15 0.85
16 0.78
17 0.76
18 0.71
19 0.62
20 0.51
21 0.41
22 0.33
23 0.26
24 0.24
25 0.19
26 0.19
27 0.22
28 0.27
29 0.33
30 0.35
31 0.38
32 0.42
33 0.41
34 0.39
35 0.42
36 0.42
37 0.36
38 0.36
39 0.32
40 0.27
41 0.25
42 0.23
43 0.18
44 0.16
45 0.14
46 0.12
47 0.13
48 0.13
49 0.12
50 0.14
51 0.15
52 0.14
53 0.14
54 0.17
55 0.17
56 0.18
57 0.19
58 0.22
59 0.22
60 0.22
61 0.22
62 0.19
63 0.2
64 0.2
65 0.19
66 0.15
67 0.13
68 0.17
69 0.19
70 0.23
71 0.27
72 0.34
73 0.37
74 0.41
75 0.46
76 0.51
77 0.57
78 0.61
79 0.61
80 0.62
81 0.6
82 0.6
83 0.57
84 0.5
85 0.43
86 0.36
87 0.31
88 0.28
89 0.29
90 0.27
91 0.3
92 0.29