Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A6QXS9

Protein Details
Accession A6QXS9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-30APAASSGGKKQKKKWSKGKVKDKANHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-24GGKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 13, mito_nucl 10.333, cyto_nucl 9.833, mito 6.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG aje:HCAG_02186  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAASSGGKKQKKKWSKGKVKDKANHAVVLDKATSEKLYKDVQSYRLITVATLVDRLKINGSLARQALADLEEKGQIKKVVGHSKMNIYTRAVTAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.83
4 0.86
5 0.91
6 0.93
7 0.92
8 0.92
9 0.88
10 0.84
11 0.82
12 0.74
13 0.66
14 0.55
15 0.49
16 0.39
17 0.34
18 0.26
19 0.17
20 0.15
21 0.12
22 0.13
23 0.1
24 0.1
25 0.11
26 0.14
27 0.15
28 0.18
29 0.2
30 0.23
31 0.26
32 0.27
33 0.25
34 0.23
35 0.22
36 0.17
37 0.16
38 0.13
39 0.08
40 0.09
41 0.08
42 0.09
43 0.09
44 0.1
45 0.09
46 0.09
47 0.1
48 0.11
49 0.12
50 0.14
51 0.15
52 0.15
53 0.14
54 0.13
55 0.13
56 0.11
57 0.11
58 0.08
59 0.09
60 0.12
61 0.13
62 0.14
63 0.16
64 0.16
65 0.16
66 0.21
67 0.29
68 0.35
69 0.38
70 0.44
71 0.44
72 0.51
73 0.56
74 0.54
75 0.48
76 0.42
77 0.4
78 0.35