Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6QU69

Protein Details
Accession A6QU69   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
204-232GKRLTRVCDSCRRKRKRCQHRRVVDENDPBasic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
KEGG aje:HCAG_00925  -  
Amino Acid Sequences MARRCSYCGRFGNPESINEETGLCHKCHKDIQPSSKSGVASLAGKSGEGPSKVAAAVMLQMAAVDVSDDSNSAGSITSIHSDQDHDDEDNSCVDRNGDGNESENTKPNSQKLRSRGSSNVSSNREIESELCARCWKNPSTTILYNTPICGECYQIAQEKREHTKGTKEKRSGASPNQQVAKRGLRRFSNNQKRFQPPTPDLQPGKRLTRVCDSCRRKRKRCQHRRVVDENDPDADFRKRSRKVQTSTVTNGREGRSRTSSSSVIEVNDTVIVSETEQDAIAAPCTGDTTTIGTGTVVDSSLTASAVDSKGCSTSNLQRAVEESVHVVFSREMDRLVGAAEEKLSDAAVALDDIKEHMTAWLERVNEGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.49
3 0.45
4 0.4
5 0.32
6 0.3
7 0.22
8 0.26
9 0.25
10 0.21
11 0.25
12 0.26
13 0.3
14 0.38
15 0.44
16 0.49
17 0.56
18 0.66
19 0.68
20 0.7
21 0.68
22 0.64
23 0.56
24 0.46
25 0.38
26 0.29
27 0.23
28 0.2
29 0.2
30 0.16
31 0.16
32 0.16
33 0.17
34 0.2
35 0.18
36 0.19
37 0.16
38 0.18
39 0.18
40 0.17
41 0.13
42 0.09
43 0.09
44 0.08
45 0.07
46 0.06
47 0.06
48 0.06
49 0.05
50 0.04
51 0.03
52 0.03
53 0.04
54 0.04
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.06
63 0.07
64 0.08
65 0.08
66 0.09
67 0.09
68 0.11
69 0.12
70 0.14
71 0.15
72 0.14
73 0.15
74 0.16
75 0.16
76 0.16
77 0.16
78 0.13
79 0.11
80 0.11
81 0.11
82 0.11
83 0.12
84 0.12
85 0.12
86 0.14
87 0.16
88 0.19
89 0.2
90 0.24
91 0.25
92 0.27
93 0.29
94 0.33
95 0.41
96 0.42
97 0.48
98 0.49
99 0.56
100 0.56
101 0.58
102 0.57
103 0.53
104 0.56
105 0.54
106 0.56
107 0.5
108 0.48
109 0.45
110 0.41
111 0.35
112 0.28
113 0.23
114 0.19
115 0.19
116 0.17
117 0.17
118 0.19
119 0.19
120 0.22
121 0.27
122 0.25
123 0.25
124 0.29
125 0.33
126 0.37
127 0.39
128 0.4
129 0.37
130 0.37
131 0.32
132 0.29
133 0.25
134 0.19
135 0.17
136 0.14
137 0.12
138 0.1
139 0.11
140 0.13
141 0.17
142 0.18
143 0.19
144 0.22
145 0.26
146 0.3
147 0.33
148 0.33
149 0.29
150 0.37
151 0.44
152 0.51
153 0.55
154 0.53
155 0.56
156 0.57
157 0.61
158 0.57
159 0.55
160 0.54
161 0.5
162 0.51
163 0.49
164 0.47
165 0.43
166 0.41
167 0.42
168 0.4
169 0.39
170 0.39
171 0.38
172 0.43
173 0.5
174 0.57
175 0.6
176 0.59
177 0.63
178 0.65
179 0.67
180 0.67
181 0.64
182 0.61
183 0.52
184 0.54
185 0.51
186 0.52
187 0.48
188 0.44
189 0.46
190 0.41
191 0.42
192 0.4
193 0.37
194 0.34
195 0.41
196 0.44
197 0.43
198 0.5
199 0.54
200 0.59
201 0.69
202 0.76
203 0.75
204 0.81
205 0.86
206 0.87
207 0.9
208 0.91
209 0.91
210 0.9
211 0.9
212 0.87
213 0.84
214 0.8
215 0.73
216 0.64
217 0.54
218 0.45
219 0.37
220 0.31
221 0.26
222 0.19
223 0.19
224 0.27
225 0.3
226 0.37
227 0.47
228 0.54
229 0.56
230 0.65
231 0.67
232 0.64
233 0.66
234 0.66
235 0.57
236 0.5
237 0.49
238 0.41
239 0.39
240 0.34
241 0.34
242 0.31
243 0.32
244 0.33
245 0.33
246 0.34
247 0.3
248 0.31
249 0.26
250 0.22
251 0.2
252 0.17
253 0.14
254 0.12
255 0.11
256 0.08
257 0.07
258 0.07
259 0.06
260 0.07
261 0.07
262 0.07
263 0.07
264 0.07
265 0.07
266 0.07
267 0.08
268 0.07
269 0.06
270 0.06
271 0.07
272 0.07
273 0.06
274 0.07
275 0.09
276 0.1
277 0.1
278 0.1
279 0.09
280 0.09
281 0.09
282 0.09
283 0.06
284 0.05
285 0.05
286 0.06
287 0.06
288 0.06
289 0.06
290 0.06
291 0.09
292 0.09
293 0.1
294 0.1
295 0.1
296 0.12
297 0.12
298 0.14
299 0.16
300 0.24
301 0.31
302 0.37
303 0.37
304 0.36
305 0.37
306 0.4
307 0.35
308 0.27
309 0.22
310 0.16
311 0.17
312 0.16
313 0.16
314 0.12
315 0.13
316 0.15
317 0.14
318 0.13
319 0.13
320 0.13
321 0.12
322 0.12
323 0.11
324 0.09
325 0.1
326 0.1
327 0.09
328 0.09
329 0.09
330 0.09
331 0.07
332 0.07
333 0.06
334 0.06
335 0.06
336 0.07
337 0.07
338 0.07
339 0.08
340 0.09
341 0.09
342 0.08
343 0.1
344 0.13
345 0.14
346 0.17
347 0.2
348 0.2