Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6R3I4

Protein Details
Accession A6R3I4   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
84-104ALNNERRRRKRGKHMGLLNPSHydrophilic
NLS Segment(s)
PositionSequence
89-96RRRRKRGK
173-185RREEAKAAAAAKH
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
KEGG aje:HCAG_04192  -  
Amino Acid Sequences MTTGIHPIDPARVLKKIQPRPLTPPELLQQRTPTSIRALQGLIKQASQRHRRLSVDIKKILRAGENIALDREVLLIENKNLQTALNNERRRRKRGKHMGLLNPSNPSLAQFFSPTKVQAAREQADANETAKINDQARKEDMKLQRAILREQKQAELMERKEQREKERLEAAQRREEAKAAAAAKHFGKEGTRGGLKEAYKKINCGLKTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.43
3 0.49
4 0.55
5 0.59
6 0.6
7 0.65
8 0.72
9 0.71
10 0.62
11 0.58
12 0.55
13 0.56
14 0.53
15 0.48
16 0.45
17 0.41
18 0.44
19 0.41
20 0.35
21 0.32
22 0.34
23 0.31
24 0.28
25 0.26
26 0.26
27 0.28
28 0.32
29 0.27
30 0.25
31 0.26
32 0.3
33 0.38
34 0.43
35 0.46
36 0.47
37 0.51
38 0.52
39 0.56
40 0.61
41 0.61
42 0.61
43 0.62
44 0.57
45 0.54
46 0.53
47 0.47
48 0.39
49 0.31
50 0.25
51 0.23
52 0.23
53 0.21
54 0.2
55 0.19
56 0.16
57 0.15
58 0.12
59 0.06
60 0.05
61 0.06
62 0.06
63 0.07
64 0.11
65 0.11
66 0.11
67 0.11
68 0.11
69 0.11
70 0.14
71 0.22
72 0.27
73 0.33
74 0.39
75 0.49
76 0.55
77 0.62
78 0.67
79 0.68
80 0.7
81 0.75
82 0.79
83 0.78
84 0.8
85 0.8
86 0.77
87 0.72
88 0.61
89 0.51
90 0.42
91 0.33
92 0.25
93 0.18
94 0.11
95 0.09
96 0.08
97 0.09
98 0.1
99 0.11
100 0.12
101 0.12
102 0.13
103 0.14
104 0.15
105 0.17
106 0.23
107 0.22
108 0.23
109 0.23
110 0.22
111 0.21
112 0.2
113 0.16
114 0.13
115 0.12
116 0.11
117 0.12
118 0.15
119 0.16
120 0.19
121 0.2
122 0.21
123 0.25
124 0.27
125 0.27
126 0.33
127 0.36
128 0.38
129 0.39
130 0.38
131 0.38
132 0.37
133 0.41
134 0.41
135 0.41
136 0.4
137 0.39
138 0.38
139 0.37
140 0.36
141 0.37
142 0.36
143 0.32
144 0.36
145 0.4
146 0.42
147 0.47
148 0.51
149 0.52
150 0.54
151 0.55
152 0.52
153 0.55
154 0.54
155 0.57
156 0.59
157 0.58
158 0.57
159 0.56
160 0.53
161 0.46
162 0.44
163 0.35
164 0.29
165 0.29
166 0.23
167 0.23
168 0.22
169 0.24
170 0.24
171 0.24
172 0.22
173 0.18
174 0.19
175 0.2
176 0.22
177 0.26
178 0.29
179 0.27
180 0.3
181 0.36
182 0.36
183 0.41
184 0.44
185 0.47
186 0.45
187 0.47
188 0.51
189 0.52