Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3S904

Protein Details
Accession E3S904    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
9-28SKAAAPKKPTQRVQRGARVIHydrophilic
NLS Segment(s)
PositionSequence
10-32KAAAPKKPTQRVQRGARVIKPKK
68-89KGGKRDKKEGAKKEGGDKKKSG
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG pte:PTT_19494  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGAVKNSKAAAPKKPTQRVQRGARVIKPKKTSIITQNKIKHKSSSGLVGQTEKLLAQKAGHLEMLKGGKRDKKEGAKKEGGDKKKSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.58
3 0.66
4 0.71
5 0.73
6 0.79
7 0.79
8 0.8
9 0.81
10 0.8
11 0.76
12 0.74
13 0.75
14 0.71
15 0.69
16 0.66
17 0.59
18 0.56
19 0.53
20 0.51
21 0.51
22 0.55
23 0.53
24 0.57
25 0.62
26 0.64
27 0.66
28 0.63
29 0.55
30 0.46
31 0.43
32 0.35
33 0.33
34 0.27
35 0.25
36 0.24
37 0.22
38 0.2
39 0.18
40 0.16
41 0.11
42 0.1
43 0.08
44 0.08
45 0.07
46 0.1
47 0.11
48 0.12
49 0.14
50 0.13
51 0.12
52 0.16
53 0.21
54 0.21
55 0.21
56 0.25
57 0.29
58 0.33
59 0.39
60 0.43
61 0.49
62 0.57
63 0.64
64 0.69
65 0.72
66 0.71
67 0.76
68 0.77
69 0.74