Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6R549

Protein Details
Accession A6R549    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
102-121MIRSNRKKAAKAKAASKKKAHydrophilic
NLS Segment(s)
PositionSequence
106-121NRKKAAKAKAASKKKA
Subcellular Location(s) plas 20, mito 4, pero 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
KEGG aje:HCAG_04757  -  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MIPMLFCRPRPSQEEAGENLTFLNPDYYSAISNFGRLIGLAMLLVATAVYLYYTAWTLLMPFVDDGHPLHDLFPPRVWAIRIPVILTLLGSAVVGSFLGVVMIRSNRKKAAKAKAASKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.49
3 0.5
4 0.44
5 0.39
6 0.32
7 0.24
8 0.19
9 0.14
10 0.13
11 0.07
12 0.09
13 0.11
14 0.11
15 0.12
16 0.12
17 0.16
18 0.14
19 0.15
20 0.13
21 0.12
22 0.11
23 0.09
24 0.1
25 0.05
26 0.05
27 0.04
28 0.04
29 0.03
30 0.03
31 0.03
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.03
40 0.03
41 0.03
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.06
52 0.06
53 0.07
54 0.08
55 0.08
56 0.09
57 0.11
58 0.13
59 0.13
60 0.14
61 0.14
62 0.14
63 0.16
64 0.16
65 0.14
66 0.17
67 0.2
68 0.19
69 0.18
70 0.18
71 0.17
72 0.16
73 0.14
74 0.1
75 0.06
76 0.05
77 0.05
78 0.04
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.02
85 0.03
86 0.03
87 0.03
88 0.06
89 0.1
90 0.17
91 0.21
92 0.25
93 0.33
94 0.38
95 0.46
96 0.52
97 0.59
98 0.63
99 0.66
100 0.73
101 0.76