Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3S9P5

Protein Details
Accession E3S9P5    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-88ILNAVPKKKTSYRKKRQRFMAGKGHydrophilic
126-154INWSIRRPTHKQAKQLKRDRRFEAQRSRTHydrophilic
NLS Segment(s)
PositionSequence
71-82KKKTSYRKKRQR
142-143KR
Subcellular Location(s) mito 18.5, cyto_mito 10.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pte:PTT_19781  -  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MALARPLPPLWQTLLPGLNGPMRPILSSPFLQRLSQPFNTPFGALALPSLSLPSLPSIADIWDGILNAVPKKKTSYRKKRQRFMAGKGLKDITALNTCSGCGRVKRMHILCPYCVDAIKTSIFGQINWSIRRPTHKQAKQLKRDRRFEAQRSRTLMPDPRKQKEEQVLKHTGWKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.23
4 0.23
5 0.24
6 0.22
7 0.21
8 0.19
9 0.18
10 0.18
11 0.18
12 0.19
13 0.18
14 0.2
15 0.23
16 0.27
17 0.28
18 0.28
19 0.3
20 0.34
21 0.37
22 0.37
23 0.38
24 0.34
25 0.35
26 0.35
27 0.32
28 0.26
29 0.2
30 0.18
31 0.13
32 0.11
33 0.08
34 0.07
35 0.07
36 0.07
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.07
44 0.07
45 0.07
46 0.08
47 0.07
48 0.07
49 0.07
50 0.07
51 0.06
52 0.07
53 0.08
54 0.09
55 0.12
56 0.11
57 0.12
58 0.16
59 0.24
60 0.33
61 0.43
62 0.53
63 0.62
64 0.73
65 0.82
66 0.86
67 0.87
68 0.88
69 0.84
70 0.79
71 0.78
72 0.72
73 0.62
74 0.56
75 0.47
76 0.36
77 0.29
78 0.23
79 0.14
80 0.13
81 0.13
82 0.12
83 0.11
84 0.11
85 0.11
86 0.13
87 0.12
88 0.1
89 0.15
90 0.18
91 0.21
92 0.29
93 0.3
94 0.35
95 0.4
96 0.42
97 0.38
98 0.37
99 0.37
100 0.29
101 0.27
102 0.22
103 0.16
104 0.16
105 0.15
106 0.13
107 0.12
108 0.16
109 0.16
110 0.15
111 0.18
112 0.21
113 0.26
114 0.27
115 0.29
116 0.26
117 0.28
118 0.35
119 0.38
120 0.42
121 0.47
122 0.51
123 0.59
124 0.68
125 0.77
126 0.8
127 0.84
128 0.86
129 0.84
130 0.87
131 0.83
132 0.83
133 0.82
134 0.81
135 0.82
136 0.8
137 0.77
138 0.75
139 0.7
140 0.62
141 0.59
142 0.58
143 0.55
144 0.57
145 0.59
146 0.6
147 0.63
148 0.63
149 0.66
150 0.67
151 0.69
152 0.68
153 0.67
154 0.65
155 0.62