Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6R766

Protein Details
Accession A6R766    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
96-121KLLLNRGKGSRKKKSHQRMQKLAAEVHydrophilic
NLS Segment(s)
PositionSequence
101-111RGKGSRKKKSH
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018247  EF_Hand_1_Ca_BS  
KEGG aje:HCAG_05474  -  
PROSITE View protein in PROSITE  
PS00018  EF_HAND_1  
Amino Acid Sequences MNIVKREPNPEPGRDSEFDFDFDDDGDIDDYDLKQLSPEELEKAFRLMSEIPDKVLEQGSDAMEKWLRKHKGQSKPISARGWTDLWNVTNYKNAAKLLLNRGKGSRKKKSHQRMQKLAAEVIGVAVIQSYCT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.4
4 0.36
5 0.33
6 0.3
7 0.26
8 0.2
9 0.18
10 0.15
11 0.11
12 0.11
13 0.09
14 0.07
15 0.07
16 0.08
17 0.07
18 0.08
19 0.08
20 0.07
21 0.07
22 0.07
23 0.08
24 0.09
25 0.1
26 0.12
27 0.13
28 0.15
29 0.14
30 0.15
31 0.14
32 0.12
33 0.13
34 0.11
35 0.13
36 0.17
37 0.17
38 0.16
39 0.17
40 0.17
41 0.16
42 0.16
43 0.12
44 0.08
45 0.1
46 0.09
47 0.09
48 0.09
49 0.09
50 0.11
51 0.11
52 0.13
53 0.2
54 0.22
55 0.23
56 0.33
57 0.4
58 0.49
59 0.57
60 0.63
61 0.64
62 0.68
63 0.72
64 0.65
65 0.57
66 0.49
67 0.43
68 0.36
69 0.28
70 0.24
71 0.2
72 0.18
73 0.2
74 0.19
75 0.16
76 0.2
77 0.19
78 0.18
79 0.19
80 0.18
81 0.18
82 0.19
83 0.24
84 0.3
85 0.36
86 0.37
87 0.36
88 0.41
89 0.48
90 0.54
91 0.58
92 0.59
93 0.62
94 0.7
95 0.79
96 0.85
97 0.87
98 0.89
99 0.91
100 0.9
101 0.89
102 0.85
103 0.78
104 0.68
105 0.58
106 0.47
107 0.36
108 0.25
109 0.17
110 0.1
111 0.06
112 0.06