Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A6R0P6

Protein Details
Accession A6R0P6    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
223-243NPTEGKPGKLKRNDIQRQVKAHydrophilic
NLS Segment(s)
PositionSequence
155-164KKKKLNTPKK
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
KEGG aje:HCAG_03203  -  
Amino Acid Sequences MAGIPEAETDIPATMSKLARSVLDDTFYNIIHDLVSKVHREEKIARMRSAVVLAKKIGEEETNRLQKQEGALENGSAELSAATPSNLKQKDSNLVRVETDGAIYENGLSGRLTKRNLTPMESGTSAPVPLPTKPSMLKRALPNGDDDTASGSIPKKKKLNTPKKYASMKPTPPSKLKIGTTPDMAAAMEFPDSTPTSAGGGGDVEPASATTTTIVTTSKKKLNPTEGKPGKLKRNDIQRQVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.16
5 0.16
6 0.17
7 0.2
8 0.22
9 0.2
10 0.21
11 0.21
12 0.22
13 0.23
14 0.22
15 0.19
16 0.16
17 0.14
18 0.12
19 0.12
20 0.1
21 0.11
22 0.14
23 0.16
24 0.18
25 0.24
26 0.25
27 0.29
28 0.34
29 0.4
30 0.47
31 0.5
32 0.49
33 0.44
34 0.44
35 0.41
36 0.4
37 0.35
38 0.28
39 0.25
40 0.24
41 0.24
42 0.22
43 0.22
44 0.18
45 0.16
46 0.16
47 0.19
48 0.28
49 0.35
50 0.35
51 0.34
52 0.34
53 0.33
54 0.32
55 0.33
56 0.26
57 0.23
58 0.23
59 0.22
60 0.22
61 0.2
62 0.18
63 0.11
64 0.09
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.05
71 0.07
72 0.15
73 0.16
74 0.18
75 0.19
76 0.22
77 0.31
78 0.34
79 0.41
80 0.35
81 0.35
82 0.34
83 0.32
84 0.31
85 0.21
86 0.18
87 0.1
88 0.08
89 0.07
90 0.06
91 0.06
92 0.05
93 0.05
94 0.05
95 0.05
96 0.06
97 0.09
98 0.12
99 0.14
100 0.15
101 0.17
102 0.24
103 0.25
104 0.27
105 0.26
106 0.24
107 0.25
108 0.24
109 0.22
110 0.16
111 0.15
112 0.12
113 0.1
114 0.11
115 0.09
116 0.09
117 0.13
118 0.13
119 0.15
120 0.18
121 0.22
122 0.26
123 0.29
124 0.33
125 0.32
126 0.39
127 0.4
128 0.37
129 0.36
130 0.32
131 0.3
132 0.25
133 0.22
134 0.16
135 0.14
136 0.14
137 0.12
138 0.12
139 0.18
140 0.2
141 0.26
142 0.29
143 0.32
144 0.42
145 0.52
146 0.61
147 0.63
148 0.7
149 0.73
150 0.77
151 0.8
152 0.75
153 0.72
154 0.71
155 0.69
156 0.66
157 0.66
158 0.62
159 0.6
160 0.59
161 0.56
162 0.52
163 0.47
164 0.47
165 0.45
166 0.42
167 0.4
168 0.36
169 0.32
170 0.26
171 0.24
172 0.17
173 0.11
174 0.08
175 0.06
176 0.06
177 0.05
178 0.08
179 0.09
180 0.09
181 0.1
182 0.1
183 0.1
184 0.11
185 0.11
186 0.08
187 0.08
188 0.08
189 0.09
190 0.08
191 0.07
192 0.07
193 0.07
194 0.08
195 0.08
196 0.07
197 0.07
198 0.07
199 0.08
200 0.09
201 0.1
202 0.12
203 0.18
204 0.25
205 0.31
206 0.35
207 0.43
208 0.5
209 0.59
210 0.66
211 0.67
212 0.72
213 0.71
214 0.73
215 0.74
216 0.74
217 0.73
218 0.72
219 0.73
220 0.7
221 0.74
222 0.78
223 0.8