Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6XPM6

Protein Details
Accession A6XPM6    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
52-77LQTALNNERRRRKRGKRMGLLNPSNPHydrophilic
NLS Segment(s)
PositionSequence
60-68RRRRKRGKR
Subcellular Location(s) nucl 17, mito 9
Family & Domain DBs
KEGG aje:HCAG_09349  -  
Amino Acid Sequences QRTPTSIRALRGLIKQASQRHRRLSVDIKKILRAGENIALDREVLLIENKNLQTALNNERRRRKRGKRMGLLNPSNPSLAQFFSPTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.4
3 0.44
4 0.51
5 0.55
6 0.57
7 0.57
8 0.61
9 0.59
10 0.6
11 0.62
12 0.61
13 0.61
14 0.62
15 0.56
16 0.53
17 0.52
18 0.46
19 0.37
20 0.29
21 0.23
22 0.21
23 0.2
24 0.19
25 0.18
26 0.17
27 0.14
28 0.13
29 0.1
30 0.05
31 0.04
32 0.05
33 0.05
34 0.06
35 0.09
36 0.09
37 0.09
38 0.1
39 0.09
40 0.1
41 0.14
42 0.21
43 0.28
44 0.34
45 0.41
46 0.51
47 0.58
48 0.65
49 0.72
50 0.75
51 0.77
52 0.81
53 0.86
54 0.86
55 0.89
56 0.91
57 0.9
58 0.86
59 0.8
60 0.72
61 0.63
62 0.54
63 0.44
64 0.35
65 0.27
66 0.22
67 0.18