Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RUR3

Protein Details
Accession E3RUR3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGKRHNRKRTRSRPRNRDNNNNTTAQHydrophilic
NLS Segment(s)
PositionSequence
3-15KRHNRKRTRSRPR
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6
Family & Domain DBs
KEGG pte:PTT_12853  -  
Amino Acid Sequences MGKRHNRKRTRSRPRNRDNNNNTTAQLKTHIRSESVSTTSSTLSATSSCFQPQGFPLANVHWQQTYNAAWQNRLRIQQEQQHEQELETQRLRIFGGLPEDERCLMEPMLKVVTDLFDGFFDYEDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.96
3 0.94
4 0.93
5 0.91
6 0.89
7 0.82
8 0.74
9 0.64
10 0.55
11 0.47
12 0.36
13 0.33
14 0.28
15 0.25
16 0.28
17 0.28
18 0.26
19 0.27
20 0.3
21 0.28
22 0.26
23 0.25
24 0.2
25 0.2
26 0.19
27 0.18
28 0.14
29 0.1
30 0.08
31 0.08
32 0.09
33 0.09
34 0.1
35 0.1
36 0.11
37 0.1
38 0.11
39 0.11
40 0.15
41 0.14
42 0.13
43 0.14
44 0.14
45 0.18
46 0.18
47 0.18
48 0.14
49 0.13
50 0.13
51 0.14
52 0.14
53 0.13
54 0.16
55 0.16
56 0.18
57 0.2
58 0.24
59 0.26
60 0.29
61 0.29
62 0.28
63 0.33
64 0.36
65 0.4
66 0.42
67 0.4
68 0.39
69 0.37
70 0.33
71 0.36
72 0.33
73 0.31
74 0.26
75 0.26
76 0.22
77 0.23
78 0.23
79 0.16
80 0.14
81 0.12
82 0.16
83 0.16
84 0.17
85 0.18
86 0.2
87 0.2
88 0.19
89 0.18
90 0.16
91 0.15
92 0.17
93 0.16
94 0.17
95 0.18
96 0.17
97 0.16
98 0.14
99 0.15
100 0.13
101 0.13
102 0.11
103 0.09
104 0.11
105 0.11