Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6R938

Protein Details
Accession A6R938    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-21DKSTCGKPCRYDNKKCMDCNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
KEGG aje:HCAG_06829  -  
Amino Acid Sequences MDKSTCGKPCRYDNKKCMDCNFTDYKPLRWYTANAAPKKQAGNSEYRVVDRHDHSCTFHQRLVGDRANSMSKRPMKIGEKSTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.79
4 0.74
5 0.68
6 0.61
7 0.57
8 0.55
9 0.44
10 0.46
11 0.42
12 0.41
13 0.4
14 0.39
15 0.35
16 0.31
17 0.32
18 0.29
19 0.36
20 0.4
21 0.36
22 0.37
23 0.36
24 0.37
25 0.36
26 0.31
27 0.27
28 0.21
29 0.24
30 0.25
31 0.28
32 0.27
33 0.26
34 0.26
35 0.24
36 0.26
37 0.23
38 0.24
39 0.23
40 0.23
41 0.25
42 0.31
43 0.36
44 0.36
45 0.35
46 0.34
47 0.32
48 0.35
49 0.39
50 0.38
51 0.32
52 0.29
53 0.3
54 0.35
55 0.34
56 0.32
57 0.34
58 0.35
59 0.37
60 0.39
61 0.45
62 0.45
63 0.53