Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6R1V7

Protein Details
Accession A6R1V7    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
79-101MAITSEKEKKRKDTHRWQTGPEWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 13.333, nucl 8, cyto_nucl 5.333
Family & Domain DBs
KEGG aje:HCAG_03615  -  
Amino Acid Sequences MAVQHGDSLGATMRAQKSPQHSRRHKYSVQNTLECKPPVLLTSVCNKQSVTAYYTCIAHYTPAFLIRCTGTASFKEQHMAITSEKEKKRKDTHRWQTGPEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.24
4 0.32
5 0.42
6 0.5
7 0.55
8 0.62
9 0.68
10 0.76
11 0.79
12 0.77
13 0.76
14 0.78
15 0.77
16 0.74
17 0.72
18 0.66
19 0.6
20 0.59
21 0.49
22 0.4
23 0.31
24 0.24
25 0.19
26 0.19
27 0.17
28 0.13
29 0.19
30 0.23
31 0.23
32 0.24
33 0.23
34 0.21
35 0.22
36 0.21
37 0.18
38 0.14
39 0.14
40 0.15
41 0.15
42 0.14
43 0.13
44 0.11
45 0.1
46 0.09
47 0.09
48 0.09
49 0.13
50 0.14
51 0.13
52 0.15
53 0.14
54 0.15
55 0.15
56 0.16
57 0.13
58 0.14
59 0.19
60 0.2
61 0.2
62 0.22
63 0.19
64 0.2
65 0.2
66 0.21
67 0.17
68 0.21
69 0.26
70 0.33
71 0.39
72 0.45
73 0.48
74 0.55
75 0.64
76 0.69
77 0.74
78 0.77
79 0.82
80 0.86
81 0.85