Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S5S9

Protein Details
Accession E3S5S9    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
30-70RAANKATTRRRSHKRKRIQAEGARSDRKKLKTRVRAKGGEPBasic
NLS Segment(s)
PositionSequence
34-68KATTRRRSHKRKRIQAEGARSDRKKLKTRVRAKGG
Subcellular Location(s) mito 17, nucl 10
Family & Domain DBs
KEGG pte:PTT_18026  -  
Amino Acid Sequences MVQAFKKVLKGAAIIAHKLVLAQKEIAELRAANKATTRRRSHKRKRIQAEGARSDRKKLKTRVRAKGGEPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.2
4 0.18
5 0.17
6 0.17
7 0.12
8 0.11
9 0.11
10 0.1
11 0.13
12 0.14
13 0.13
14 0.12
15 0.11
16 0.11
17 0.15
18 0.16
19 0.13
20 0.16
21 0.22
22 0.28
23 0.37
24 0.42
25 0.46
26 0.57
27 0.68
28 0.76
29 0.8
30 0.84
31 0.85
32 0.87
33 0.88
34 0.88
35 0.85
36 0.83
37 0.82
38 0.78
39 0.77
40 0.69
41 0.66
42 0.63
43 0.63
44 0.63
45 0.64
46 0.67
47 0.69
48 0.79
49 0.83
50 0.85
51 0.84