Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6RAI2

Protein Details
Accession A6RAI2    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
148-170VVEAERREKRKQMRKLGERVDELBasic
NLS Segment(s)
PositionSequence
154-159REKRKQ
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR037212  Med7/Med21-like  
IPR021384  Mediator_Med21  
Gene Ontology GO:0016592  C:mediator complex  
KEGG aje:HCAG_05970  -  
Pfam View protein in Pfam  
PF11221  Med21  
Amino Acid Sequences MADILTQLQTCLDQLATQFYATLCYLTTYHDHAPATPPSNIPTAIPQLKKIPKNPSPTATTSTTTKAASPQPTTPAAADAQAQQQEPSPAEPTPDPPEIFALRQRELARDLIIKEQQIEYLISVLPGVGSSEAEQEERIRRLAEELRVVEAERREKRKQMRKLGERVDELLEAVEGTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.14
3 0.14
4 0.14
5 0.14
6 0.13
7 0.16
8 0.15
9 0.15
10 0.1
11 0.11
12 0.11
13 0.13
14 0.15
15 0.17
16 0.19
17 0.22
18 0.22
19 0.21
20 0.25
21 0.28
22 0.29
23 0.26
24 0.25
25 0.24
26 0.26
27 0.25
28 0.21
29 0.19
30 0.23
31 0.28
32 0.28
33 0.28
34 0.35
35 0.42
36 0.47
37 0.5
38 0.52
39 0.53
40 0.6
41 0.62
42 0.58
43 0.56
44 0.53
45 0.52
46 0.45
47 0.4
48 0.34
49 0.32
50 0.3
51 0.25
52 0.22
53 0.21
54 0.23
55 0.25
56 0.25
57 0.24
58 0.26
59 0.26
60 0.27
61 0.23
62 0.2
63 0.16
64 0.13
65 0.12
66 0.1
67 0.12
68 0.12
69 0.12
70 0.11
71 0.11
72 0.12
73 0.12
74 0.12
75 0.11
76 0.09
77 0.11
78 0.11
79 0.13
80 0.17
81 0.18
82 0.17
83 0.16
84 0.18
85 0.18
86 0.19
87 0.2
88 0.19
89 0.18
90 0.22
91 0.22
92 0.22
93 0.23
94 0.23
95 0.2
96 0.19
97 0.19
98 0.19
99 0.2
100 0.19
101 0.18
102 0.17
103 0.16
104 0.15
105 0.14
106 0.1
107 0.09
108 0.09
109 0.07
110 0.07
111 0.06
112 0.05
113 0.04
114 0.04
115 0.04
116 0.04
117 0.05
118 0.07
119 0.08
120 0.08
121 0.09
122 0.12
123 0.16
124 0.17
125 0.18
126 0.17
127 0.17
128 0.21
129 0.26
130 0.27
131 0.28
132 0.28
133 0.29
134 0.29
135 0.3
136 0.29
137 0.29
138 0.34
139 0.36
140 0.42
141 0.45
142 0.53
143 0.63
144 0.69
145 0.74
146 0.76
147 0.79
148 0.82
149 0.87
150 0.87
151 0.84
152 0.77
153 0.7
154 0.61
155 0.5
156 0.41
157 0.31
158 0.22