Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6RE16

Protein Details
Accession A6RE16    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
73-95VTGKEQRMTERAKKRRKKKHLSRBasic
NLS Segment(s)
PositionSequence
79-95RMTERAKKRRKKKHLSR
Subcellular Location(s) nucl 17, mito_nucl 12.833, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
KEGG aje:HCAG_07874  -  
Amino Acid Sequences MKIKRWMNGRVNSECISLPKGMETCYAGEISMYTERENRIQVATLEKTQLIAKDFSELRIHFWPDERALKKVVTGKEQRMTERAKKRRKKKHLSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.37
3 0.31
4 0.25
5 0.2
6 0.18
7 0.17
8 0.16
9 0.17
10 0.16
11 0.15
12 0.15
13 0.15
14 0.11
15 0.1
16 0.1
17 0.11
18 0.12
19 0.12
20 0.11
21 0.13
22 0.15
23 0.17
24 0.17
25 0.16
26 0.13
27 0.14
28 0.14
29 0.16
30 0.17
31 0.16
32 0.15
33 0.14
34 0.14
35 0.14
36 0.14
37 0.11
38 0.1
39 0.1
40 0.13
41 0.13
42 0.14
43 0.18
44 0.16
45 0.19
46 0.22
47 0.23
48 0.2
49 0.22
50 0.23
51 0.23
52 0.31
53 0.29
54 0.28
55 0.28
56 0.28
57 0.3
58 0.34
59 0.33
60 0.33
61 0.38
62 0.43
63 0.48
64 0.51
65 0.5
66 0.5
67 0.54
68 0.55
69 0.59
70 0.63
71 0.66
72 0.74
73 0.82
74 0.87
75 0.91