Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A6RAQ0

Protein Details
Accession A6RAQ0    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-37KRSATGAKRSHYRKKRAFEKGRQPANTRBasic
NLS Segment(s)
PositionSequence
8-50RHKRSATGAKRSHYRKKRAFEKGRQPANTRIGPKRIHLVRTRG
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001047  Ribosomal_S8e  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0042254  P:ribosome biogenesis  
GO:0006412  P:translation  
KEGG aje:HCAG_06038  -  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
CDD cd11382  Ribosomal_S8e  
Amino Acid Sequences MGISRDSRHKRSATGAKRSHYRKKRAFEKGRQPANTRIGPKRIHLVRTRGGNQKFRGLRLESGNFSWGSEGIARKVRVIVVEKKQAARFAAQGKVEPALEKQFEAGRLYAVVSSRPGQSGRVDGYILEGEELAFYQRAIRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.66
3 0.65
4 0.72
5 0.77
6 0.78
7 0.77
8 0.78
9 0.77
10 0.8
11 0.84
12 0.86
13 0.88
14 0.88
15 0.89
16 0.89
17 0.89
18 0.84
19 0.78
20 0.75
21 0.72
22 0.67
23 0.62
24 0.58
25 0.55
26 0.52
27 0.49
28 0.5
29 0.47
30 0.47
31 0.46
32 0.46
33 0.45
34 0.5
35 0.53
36 0.53
37 0.55
38 0.55
39 0.51
40 0.54
41 0.5
42 0.45
43 0.44
44 0.38
45 0.35
46 0.33
47 0.34
48 0.27
49 0.26
50 0.26
51 0.21
52 0.19
53 0.16
54 0.1
55 0.08
56 0.09
57 0.09
58 0.09
59 0.14
60 0.14
61 0.14
62 0.15
63 0.14
64 0.15
65 0.19
66 0.24
67 0.25
68 0.31
69 0.33
70 0.36
71 0.36
72 0.36
73 0.32
74 0.27
75 0.25
76 0.22
77 0.25
78 0.22
79 0.22
80 0.21
81 0.21
82 0.2
83 0.17
84 0.15
85 0.15
86 0.15
87 0.14
88 0.15
89 0.15
90 0.17
91 0.18
92 0.16
93 0.12
94 0.12
95 0.12
96 0.12
97 0.11
98 0.1
99 0.11
100 0.13
101 0.13
102 0.15
103 0.16
104 0.16
105 0.18
106 0.21
107 0.22
108 0.21
109 0.2
110 0.18
111 0.21
112 0.2
113 0.18
114 0.13
115 0.1
116 0.09
117 0.09
118 0.09
119 0.08
120 0.07
121 0.07