Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6R426

Protein Details
Accession A6R426    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
82-114ARFAGARSKRRAKKGKVGKKKRQEQASKESAKKBasic
NLS Segment(s)
PositionSequence
81-116IARFAGARSKRRAKKGKVGKKKRQEQASKESAKKAK
Subcellular Location(s) nucl 13, mito 11, cyto 3
Family & Domain DBs
KEGG aje:HCAG_04384  -  
Amino Acid Sequences MQRKALSVRGNIRTISKLGEGGNPLDIELRTCETPHSTLLCRNSRMRRGRDPQLRQEAKVCKDEAGCQFTTSAPGLKRALIARFAGARSKRRAKKGKVGKKKRQEQASKESAKKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.26
4 0.22
5 0.21
6 0.23
7 0.22
8 0.2
9 0.21
10 0.18
11 0.17
12 0.16
13 0.14
14 0.12
15 0.12
16 0.14
17 0.12
18 0.13
19 0.14
20 0.15
21 0.16
22 0.17
23 0.19
24 0.17
25 0.22
26 0.29
27 0.33
28 0.34
29 0.4
30 0.44
31 0.5
32 0.57
33 0.58
34 0.6
35 0.62
36 0.69
37 0.71
38 0.71
39 0.7
40 0.73
41 0.68
42 0.59
43 0.59
44 0.55
45 0.48
46 0.45
47 0.37
48 0.27
49 0.26
50 0.3
51 0.28
52 0.26
53 0.24
54 0.21
55 0.21
56 0.19
57 0.21
58 0.17
59 0.16
60 0.12
61 0.16
62 0.16
63 0.16
64 0.18
65 0.19
66 0.2
67 0.19
68 0.19
69 0.17
70 0.18
71 0.19
72 0.24
73 0.26
74 0.31
75 0.37
76 0.47
77 0.52
78 0.61
79 0.7
80 0.71
81 0.77
82 0.82
83 0.85
84 0.86
85 0.9
86 0.9
87 0.91
88 0.93
89 0.91
90 0.91
91 0.9
92 0.87
93 0.86
94 0.85
95 0.83
96 0.78