Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6R9B3

Protein Details
Accession A6R9B3   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
81-105SAENMGRIRKRVRRKTRPSITFAARHydrophilic
NLS Segment(s)
PositionSequence
86-116GRIRKRVRRKTRPSITFAARPQKVKRVNKRK
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG aje:HCAG_06904  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKGLRSSVMKRNKAKLRAEVFVPIVDRRTERLSAKLQELVAKPKEVNTSDADKLDMNITEESGAGKEMDIDEQPGATKPSAENMGRIRKRVRRKTRPSITFAARPQKVKRVNKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.75
3 0.75
4 0.7
5 0.65
6 0.6
7 0.54
8 0.46
9 0.4
10 0.35
11 0.27
12 0.23
13 0.21
14 0.2
15 0.19
16 0.21
17 0.24
18 0.23
19 0.28
20 0.32
21 0.33
22 0.35
23 0.34
24 0.31
25 0.32
26 0.32
27 0.33
28 0.29
29 0.27
30 0.25
31 0.25
32 0.28
33 0.24
34 0.25
35 0.21
36 0.25
37 0.24
38 0.25
39 0.23
40 0.18
41 0.17
42 0.16
43 0.13
44 0.1
45 0.08
46 0.08
47 0.07
48 0.07
49 0.07
50 0.06
51 0.06
52 0.04
53 0.04
54 0.04
55 0.05
56 0.06
57 0.05
58 0.06
59 0.06
60 0.06
61 0.07
62 0.07
63 0.09
64 0.08
65 0.09
66 0.08
67 0.11
68 0.17
69 0.17
70 0.2
71 0.25
72 0.36
73 0.37
74 0.42
75 0.47
76 0.5
77 0.61
78 0.67
79 0.72
80 0.73
81 0.81
82 0.88
83 0.91
84 0.9
85 0.85
86 0.83
87 0.78
88 0.75
89 0.72
90 0.71
91 0.65
92 0.64
93 0.63
94 0.64
95 0.68
96 0.71