Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6R728

Protein Details
Accession A6R728   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-25RFFAKGHRRHHSKRGANWVDBasic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 10, cyto 5
Family & Domain DBs
KEGG aje:HCAG_05436  -  
Amino Acid Sequences MPLVHRFFAKGHRRHHSKRGANWVDARSEQENKTVDRESATKGAKIGEYLKRERYKYTKRKQITVEMAETREHSGETGKEIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.78
3 0.79
4 0.77
5 0.78
6 0.8
7 0.74
8 0.7
9 0.69
10 0.6
11 0.53
12 0.45
13 0.41
14 0.33
15 0.32
16 0.28
17 0.27
18 0.27
19 0.25
20 0.28
21 0.25
22 0.21
23 0.19
24 0.2
25 0.18
26 0.22
27 0.22
28 0.19
29 0.18
30 0.19
31 0.17
32 0.17
33 0.19
34 0.19
35 0.23
36 0.26
37 0.34
38 0.38
39 0.4
40 0.44
41 0.49
42 0.54
43 0.6
44 0.67
45 0.69
46 0.69
47 0.75
48 0.74
49 0.74
50 0.72
51 0.66
52 0.62
53 0.56
54 0.53
55 0.46
56 0.43
57 0.35
58 0.26
59 0.21
60 0.16
61 0.16
62 0.15