Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6RBE2

Protein Details
Accession A6RBE2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
127-149GVVQKREKAKKLAEKEKKKLESTBasic
NLS Segment(s)
PositionSequence
131-145KREKAKKLAEKEKKK
Subcellular Location(s) mito 10, cyto 7, extr 3, E.R. 3, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013657  SCL35B1-4/HUT1  
Gene Ontology GO:0016020  C:membrane  
GO:0008643  P:carbohydrate transport  
GO:0055085  P:transmembrane transport  
KEGG aje:HCAG_06280  -  
Pfam View protein in Pfam  
PF08449  UAA  
Amino Acid Sequences MVAQNLLCTLLTTTYLLVTPHVSTSILRLMPLPIDLSQTSELASALAFLSRHPTATKDIIAFAACGAIGQLFIFHTLAHFSSLLLVTVTVTRKMLTMLLSVMWFGHRLSGGQWIGVGLVFGGIGAEGVVQKREKAKKLAEKEKKKLESTDVNKGEKQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.11
5 0.11
6 0.11
7 0.11
8 0.12
9 0.12
10 0.11
11 0.13
12 0.18
13 0.16
14 0.16
15 0.16
16 0.15
17 0.15
18 0.16
19 0.15
20 0.1
21 0.13
22 0.13
23 0.15
24 0.15
25 0.15
26 0.14
27 0.13
28 0.12
29 0.09
30 0.09
31 0.06
32 0.05
33 0.06
34 0.05
35 0.05
36 0.1
37 0.1
38 0.11
39 0.11
40 0.13
41 0.16
42 0.18
43 0.2
44 0.16
45 0.16
46 0.16
47 0.16
48 0.14
49 0.1
50 0.07
51 0.05
52 0.05
53 0.04
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.06
66 0.06
67 0.05
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.04
74 0.07
75 0.08
76 0.07
77 0.08
78 0.08
79 0.08
80 0.09
81 0.09
82 0.08
83 0.08
84 0.07
85 0.08
86 0.08
87 0.07
88 0.07
89 0.06
90 0.06
91 0.05
92 0.06
93 0.06
94 0.06
95 0.07
96 0.14
97 0.14
98 0.13
99 0.13
100 0.12
101 0.12
102 0.11
103 0.1
104 0.03
105 0.03
106 0.03
107 0.03
108 0.02
109 0.02
110 0.02
111 0.02
112 0.03
113 0.04
114 0.05
115 0.08
116 0.08
117 0.11
118 0.19
119 0.27
120 0.32
121 0.38
122 0.47
123 0.55
124 0.65
125 0.74
126 0.77
127 0.8
128 0.84
129 0.88
130 0.85
131 0.79
132 0.73
133 0.7
134 0.7
135 0.66
136 0.67
137 0.64
138 0.61