Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6R5W9

Protein Details
Accession A6R5W9   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
21-48VLEGRVGKKGNKKRKKEKERGKVKEGANBasic
NLS Segment(s)
PositionSequence
13-45KLKIKGAPVLEGRVGKKGNKKRKKEKERGKVKE
114-126ARRKRLDERLKRE
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
KEGG aje:HCAG_05027  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MAPANEYVSGGGKLKIKGAPVLEGRVGKKGNKKRKKEKERGKVKEGANEGPNGSRDEGADGMRMKSGEGEGAVRSDGDWDGSRSRSRSRSRGVSEGFDKAVVNKTEAERRYEEARRKRLDERLKREGFKTHKERVEELNRYLSNLSEHHDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.23
4 0.26
5 0.26
6 0.29
7 0.27
8 0.3
9 0.3
10 0.32
11 0.31
12 0.33
13 0.34
14 0.33
15 0.41
16 0.48
17 0.56
18 0.62
19 0.71
20 0.76
21 0.86
22 0.92
23 0.93
24 0.94
25 0.93
26 0.94
27 0.92
28 0.87
29 0.84
30 0.75
31 0.71
32 0.63
33 0.57
34 0.48
35 0.41
36 0.35
37 0.28
38 0.27
39 0.22
40 0.19
41 0.14
42 0.13
43 0.13
44 0.13
45 0.12
46 0.13
47 0.12
48 0.12
49 0.12
50 0.12
51 0.1
52 0.09
53 0.09
54 0.07
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.05
62 0.06
63 0.05
64 0.06
65 0.06
66 0.07
67 0.09
68 0.11
69 0.13
70 0.14
71 0.18
72 0.25
73 0.3
74 0.35
75 0.39
76 0.46
77 0.48
78 0.53
79 0.51
80 0.47
81 0.44
82 0.39
83 0.33
84 0.26
85 0.22
86 0.16
87 0.2
88 0.17
89 0.16
90 0.16
91 0.18
92 0.24
93 0.26
94 0.29
95 0.25
96 0.28
97 0.34
98 0.39
99 0.46
100 0.49
101 0.57
102 0.58
103 0.6
104 0.63
105 0.66
106 0.7
107 0.71
108 0.7
109 0.72
110 0.73
111 0.71
112 0.68
113 0.67
114 0.63
115 0.63
116 0.62
117 0.61
118 0.6
119 0.61
120 0.62
121 0.62
122 0.65
123 0.6
124 0.56
125 0.56
126 0.5
127 0.48
128 0.45
129 0.37
130 0.3
131 0.25
132 0.27
133 0.22
134 0.23
135 0.24
136 0.29
137 0.28