Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S2K4

Protein Details
Accession E3S2K4    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
257-281ADNDAAKKRGRRRRGKAVVRAWTVKHydrophilic
NLS Segment(s)
PositionSequence
262-279AKKRGRRRRGKAVVRAWT
281-281K
Subcellular Location(s) plas 14, mito 9, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR000182  GNAT_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0016747  F:acyltransferase activity, transferring groups other than amino-acyl groups  
KEGG pte:PTT_16546  -  
Pfam View protein in Pfam  
PF00583  Acetyltransf_1  
PROSITE View protein in PROSITE  
PS51186  GNAT  
CDD cd04301  NAT_SF  
Amino Acid Sequences MRRQLPPSHLKVPPGPHAFPRQQFLGQDTVVVNHYAGIEKAIPAIPSLPGFRTSAAFLTSLSANLRIDPDLPSPLPTPTSFQLNNFVQPLPPTSLSYTTTTTTSYNPYPSPAEHQVMSSNTPIAPVKTLTDELPQLSTYTAESQEDRVEGLRLVADSVAQQRQVASKVMMFHPVSLAAYVVTIAIAAQYMIRWYEDRLMLATTLGGITMTFLIFIRWMTGGYIGMAEDIDMEWLGDDRLIVVKWGEDVIGSLVLGWADNDAAKKRGRRRRGKAVVRAWTVKLKYRGKGVGEGLLEEAVKVAGERGADGILFDADHANSKRVLPSIFNGFLNKQDAKAEKALQKVADAKGNFRQRQSSPTWGSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.55
3 0.53
4 0.58
5 0.61
6 0.59
7 0.58
8 0.52
9 0.49
10 0.47
11 0.44
12 0.4
13 0.32
14 0.3
15 0.26
16 0.23
17 0.21
18 0.2
19 0.16
20 0.12
21 0.13
22 0.11
23 0.11
24 0.11
25 0.11
26 0.1
27 0.13
28 0.13
29 0.13
30 0.12
31 0.13
32 0.13
33 0.14
34 0.16
35 0.15
36 0.16
37 0.17
38 0.17
39 0.17
40 0.18
41 0.17
42 0.16
43 0.15
44 0.13
45 0.14
46 0.13
47 0.13
48 0.13
49 0.14
50 0.12
51 0.13
52 0.14
53 0.13
54 0.13
55 0.15
56 0.16
57 0.19
58 0.19
59 0.21
60 0.2
61 0.21
62 0.22
63 0.2
64 0.22
65 0.19
66 0.26
67 0.24
68 0.25
69 0.31
70 0.31
71 0.33
72 0.3
73 0.29
74 0.23
75 0.23
76 0.24
77 0.2
78 0.2
79 0.19
80 0.19
81 0.22
82 0.23
83 0.25
84 0.24
85 0.21
86 0.2
87 0.2
88 0.19
89 0.18
90 0.2
91 0.19
92 0.2
93 0.19
94 0.21
95 0.22
96 0.22
97 0.27
98 0.27
99 0.27
100 0.24
101 0.25
102 0.25
103 0.25
104 0.26
105 0.2
106 0.16
107 0.13
108 0.15
109 0.15
110 0.12
111 0.12
112 0.11
113 0.11
114 0.12
115 0.14
116 0.13
117 0.14
118 0.15
119 0.14
120 0.14
121 0.13
122 0.11
123 0.1
124 0.1
125 0.09
126 0.09
127 0.1
128 0.1
129 0.1
130 0.11
131 0.12
132 0.11
133 0.11
134 0.09
135 0.09
136 0.08
137 0.08
138 0.07
139 0.06
140 0.06
141 0.06
142 0.05
143 0.06
144 0.09
145 0.1
146 0.09
147 0.09
148 0.1
149 0.12
150 0.13
151 0.13
152 0.1
153 0.11
154 0.13
155 0.14
156 0.18
157 0.17
158 0.15
159 0.14
160 0.14
161 0.13
162 0.1
163 0.1
164 0.04
165 0.04
166 0.04
167 0.03
168 0.03
169 0.03
170 0.02
171 0.02
172 0.02
173 0.02
174 0.02
175 0.02
176 0.03
177 0.03
178 0.04
179 0.05
180 0.06
181 0.09
182 0.1
183 0.1
184 0.1
185 0.11
186 0.1
187 0.1
188 0.09
189 0.05
190 0.04
191 0.04
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.04
199 0.04
200 0.04
201 0.04
202 0.05
203 0.05
204 0.05
205 0.05
206 0.06
207 0.06
208 0.06
209 0.06
210 0.05
211 0.05
212 0.04
213 0.04
214 0.03
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.03
222 0.03
223 0.03
224 0.03
225 0.05
226 0.05
227 0.05
228 0.05
229 0.05
230 0.06
231 0.06
232 0.06
233 0.04
234 0.05
235 0.05
236 0.05
237 0.05
238 0.04
239 0.05
240 0.04
241 0.05
242 0.04
243 0.03
244 0.04
245 0.05
246 0.07
247 0.09
248 0.12
249 0.16
250 0.23
251 0.33
252 0.43
253 0.53
254 0.62
255 0.7
256 0.78
257 0.85
258 0.88
259 0.88
260 0.87
261 0.86
262 0.81
263 0.75
264 0.66
265 0.62
266 0.55
267 0.52
268 0.53
269 0.5
270 0.47
271 0.5
272 0.53
273 0.48
274 0.52
275 0.46
276 0.42
277 0.36
278 0.33
279 0.27
280 0.23
281 0.2
282 0.14
283 0.12
284 0.06
285 0.06
286 0.05
287 0.05
288 0.05
289 0.06
290 0.06
291 0.07
292 0.07
293 0.07
294 0.07
295 0.07
296 0.06
297 0.06
298 0.06
299 0.07
300 0.07
301 0.14
302 0.15
303 0.16
304 0.17
305 0.19
306 0.21
307 0.22
308 0.24
309 0.2
310 0.23
311 0.3
312 0.32
313 0.32
314 0.32
315 0.31
316 0.33
317 0.36
318 0.33
319 0.26
320 0.3
321 0.31
322 0.32
323 0.37
324 0.4
325 0.39
326 0.44
327 0.46
328 0.41
329 0.43
330 0.44
331 0.42
332 0.42
333 0.38
334 0.37
335 0.42
336 0.52
337 0.52
338 0.49
339 0.54
340 0.49
341 0.55
342 0.57
343 0.58