Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6RF51

Protein Details
Accession A6RF51   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-33APPGVDPAKRPQTRKKRKIPRSGRPAIVKAHydrophilic
NLS Segment(s)
PositionSequence
11-28AKRPQTRKKRKIPRSGRP
Subcellular Location(s) plas 20, mito 4, cyto 1, pero 1, E.R. 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR004299  MBOAT_fam  
Gene Ontology GO:0016020  C:membrane  
KEGG aje:HCAG_08267  -  
Pfam View protein in Pfam  
PF03062  MBOAT  
Amino Acid Sequences MFDAPPGVDPAKRPQTRKKRKIPRSGRPAIVKAAFGLVYIFGFLQFGRLYNVDFVLGDRYLKYGLLRRVWILHMLGFTSRLKYYGVWSLTEGACILSGMGYNGFDPNTGKVSWNRLENVNPKDLETAPNPHTYLSSWNKNTNHWLKNYMYLRVTPRGKKPGFRASLATFATSAFWHGFHPGYYFTFILGAFIQTTAKNFRRNIRPFFLTPDGSAPTPYKRFYDILTWLTTQLTLSFTAAPFVILHFKPSVHVWSSVYYYGIVGIAASQAFFSSPAKRYLVKRLRARGSGPVSRQPSRPREPHEPSEQPVLGLPPNPGRDIEDAVNEVMREIEVRRRRGSVVAMPSGRELMAAVEEKLGRKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.67
3 0.76
4 0.84
5 0.85
6 0.86
7 0.9
8 0.95
9 0.95
10 0.94
11 0.94
12 0.92
13 0.89
14 0.86
15 0.79
16 0.76
17 0.67
18 0.56
19 0.46
20 0.39
21 0.3
22 0.22
23 0.19
24 0.12
25 0.09
26 0.09
27 0.08
28 0.06
29 0.06
30 0.06
31 0.08
32 0.08
33 0.09
34 0.11
35 0.12
36 0.13
37 0.14
38 0.15
39 0.13
40 0.12
41 0.13
42 0.13
43 0.13
44 0.12
45 0.11
46 0.12
47 0.12
48 0.13
49 0.15
50 0.19
51 0.25
52 0.28
53 0.3
54 0.3
55 0.32
56 0.33
57 0.33
58 0.27
59 0.22
60 0.18
61 0.17
62 0.16
63 0.16
64 0.16
65 0.15
66 0.15
67 0.14
68 0.14
69 0.14
70 0.17
71 0.22
72 0.22
73 0.2
74 0.21
75 0.24
76 0.23
77 0.23
78 0.2
79 0.12
80 0.11
81 0.09
82 0.08
83 0.04
84 0.04
85 0.05
86 0.05
87 0.05
88 0.05
89 0.06
90 0.06
91 0.07
92 0.08
93 0.09
94 0.11
95 0.11
96 0.13
97 0.15
98 0.22
99 0.25
100 0.27
101 0.28
102 0.28
103 0.33
104 0.39
105 0.4
106 0.39
107 0.36
108 0.33
109 0.33
110 0.32
111 0.29
112 0.24
113 0.26
114 0.23
115 0.26
116 0.25
117 0.23
118 0.23
119 0.2
120 0.25
121 0.26
122 0.32
123 0.32
124 0.39
125 0.4
126 0.41
127 0.49
128 0.5
129 0.48
130 0.41
131 0.43
132 0.37
133 0.44
134 0.44
135 0.39
136 0.31
137 0.3
138 0.32
139 0.35
140 0.4
141 0.36
142 0.41
143 0.47
144 0.48
145 0.49
146 0.52
147 0.54
148 0.51
149 0.48
150 0.46
151 0.38
152 0.42
153 0.37
154 0.31
155 0.21
156 0.18
157 0.17
158 0.13
159 0.12
160 0.07
161 0.07
162 0.07
163 0.08
164 0.08
165 0.08
166 0.09
167 0.09
168 0.09
169 0.1
170 0.1
171 0.09
172 0.09
173 0.09
174 0.09
175 0.07
176 0.07
177 0.05
178 0.06
179 0.06
180 0.06
181 0.07
182 0.13
183 0.16
184 0.22
185 0.24
186 0.31
187 0.41
188 0.47
189 0.51
190 0.5
191 0.51
192 0.47
193 0.5
194 0.47
195 0.38
196 0.32
197 0.29
198 0.25
199 0.21
200 0.22
201 0.17
202 0.17
203 0.19
204 0.2
205 0.19
206 0.2
207 0.21
208 0.21
209 0.25
210 0.25
211 0.25
212 0.26
213 0.25
214 0.22
215 0.21
216 0.2
217 0.15
218 0.11
219 0.1
220 0.08
221 0.08
222 0.09
223 0.08
224 0.09
225 0.09
226 0.09
227 0.07
228 0.08
229 0.12
230 0.11
231 0.13
232 0.13
233 0.14
234 0.14
235 0.16
236 0.19
237 0.16
238 0.18
239 0.17
240 0.18
241 0.2
242 0.19
243 0.18
244 0.15
245 0.12
246 0.11
247 0.1
248 0.07
249 0.05
250 0.04
251 0.05
252 0.04
253 0.04
254 0.04
255 0.04
256 0.04
257 0.06
258 0.07
259 0.12
260 0.15
261 0.19
262 0.21
263 0.26
264 0.29
265 0.4
266 0.47
267 0.51
268 0.57
269 0.63
270 0.67
271 0.67
272 0.66
273 0.64
274 0.62
275 0.6
276 0.56
277 0.55
278 0.55
279 0.54
280 0.58
281 0.58
282 0.6
283 0.61
284 0.64
285 0.64
286 0.68
287 0.72
288 0.73
289 0.74
290 0.7
291 0.64
292 0.65
293 0.57
294 0.47
295 0.4
296 0.36
297 0.28
298 0.24
299 0.24
300 0.22
301 0.24
302 0.25
303 0.24
304 0.25
305 0.26
306 0.28
307 0.27
308 0.23
309 0.23
310 0.22
311 0.23
312 0.19
313 0.17
314 0.13
315 0.11
316 0.09
317 0.1
318 0.19
319 0.26
320 0.32
321 0.35
322 0.38
323 0.4
324 0.42
325 0.47
326 0.45
327 0.45
328 0.48
329 0.46
330 0.44
331 0.44
332 0.41
333 0.34
334 0.26
335 0.18
336 0.11
337 0.14
338 0.14
339 0.13
340 0.16
341 0.18