Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6QWQ8

Protein Details
Accession A6QWQ8    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-24DEPPRKITPRFTRARQEQNMHydrophilic
74-97DSLIRKERKMIRDGRKRTKTDGRSBasic
NLS Segment(s)
PositionSequence
78-93RKERKMIRDGRKRTKT
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004023  Mago_nashi  
IPR036605  Mago_nashi_sf  
Gene Ontology GO:0035145  C:exon-exon junction complex  
GO:0008380  P:RNA splicing  
KEGG aje:HCAG_01815  -  
Pfam View protein in Pfam  
PF02792  Mago_nashi  
Amino Acid Sequences MLLQDEPPRKITPRFTRARQEQNMANPNEPFYVRYYSGHSGRFGHEFLEFDFRSLGDGRSASARYANNSNYRNDSLIRKERKMIRDGRKRTKTDGRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.71
4 0.76
5 0.81
6 0.75
7 0.7
8 0.65
9 0.66
10 0.68
11 0.59
12 0.53
13 0.43
14 0.39
15 0.35
16 0.31
17 0.23
18 0.17
19 0.19
20 0.18
21 0.18
22 0.22
23 0.25
24 0.28
25 0.29
26 0.27
27 0.24
28 0.25
29 0.25
30 0.21
31 0.17
32 0.14
33 0.13
34 0.12
35 0.17
36 0.15
37 0.14
38 0.13
39 0.12
40 0.13
41 0.14
42 0.13
43 0.08
44 0.08
45 0.08
46 0.11
47 0.12
48 0.1
49 0.14
50 0.14
51 0.16
52 0.2
53 0.24
54 0.29
55 0.31
56 0.34
57 0.35
58 0.36
59 0.34
60 0.33
61 0.34
62 0.36
63 0.43
64 0.48
65 0.45
66 0.51
67 0.57
68 0.61
69 0.63
70 0.65
71 0.66
72 0.7
73 0.77
74 0.81
75 0.83
76 0.81
77 0.81