Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A6RCN2

Protein Details
Accession A6RCN2    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
51-71REYMLKQERQHWKRREKFFQVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004226  TBCA  
IPR036126  TBCA_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005874  C:microtubule  
GO:0048487  F:beta-tubulin binding  
GO:0007023  P:post-chaperonin tubulin folding pathway  
GO:0007021  P:tubulin complex assembly  
KEGG aje:HCAG_07390  -  
Pfam View protein in Pfam  
PF02970  TBCA  
Amino Acid Sequences MPPLSPLSIATAAVQRLVKEEASYHRELKQQEDRIKRLEAEQPGEDVDGNREYMLKQERQHWKRREKFFQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.14
3 0.16
4 0.17
5 0.16
6 0.13
7 0.16
8 0.19
9 0.24
10 0.27
11 0.26
12 0.28
13 0.32
14 0.32
15 0.37
16 0.39
17 0.41
18 0.46
19 0.51
20 0.5
21 0.49
22 0.49
23 0.43
24 0.36
25 0.34
26 0.29
27 0.26
28 0.24
29 0.22
30 0.21
31 0.21
32 0.18
33 0.13
34 0.12
35 0.1
36 0.1
37 0.09
38 0.09
39 0.09
40 0.15
41 0.2
42 0.23
43 0.25
44 0.34
45 0.45
46 0.52
47 0.62
48 0.66
49 0.72
50 0.76
51 0.84