Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6RES0

Protein Details
Accession A6RES0   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
145-175PENARLRLRKQEEKQKRREKEMQRKERLSTLBasic
NLS Segment(s)
PositionSequence
150-183LRLRKQEEKQKRREKEMQRKERLSTLRPRPSTRK
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 3
Family & Domain DBs
KEGG aje:HCAG_08135  -  
Amino Acid Sequences MDRQGTEGPPPLPSQLLSSGAQQSTLPAYCAVLGDFLEKTPFQTYASAPLNVPPERLSVDRASNNRPQPPGGIEPDGRDNISDSGATTEPLAHDELKNLPYWYEAQQVEKSLKICHVGDKVWRNNKYVHRVLYVVETYLPDNCLPENARLRLRKQEEKQKRREKEMQRKERLSTLRPRPSTRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.22
4 0.21
5 0.23
6 0.26
7 0.25
8 0.25
9 0.21
10 0.2
11 0.2
12 0.19
13 0.16
14 0.12
15 0.12
16 0.12
17 0.12
18 0.11
19 0.08
20 0.08
21 0.09
22 0.09
23 0.09
24 0.1
25 0.1
26 0.12
27 0.13
28 0.13
29 0.13
30 0.15
31 0.15
32 0.21
33 0.24
34 0.23
35 0.21
36 0.24
37 0.28
38 0.26
39 0.26
40 0.19
41 0.18
42 0.19
43 0.2
44 0.2
45 0.17
46 0.22
47 0.26
48 0.29
49 0.32
50 0.37
51 0.41
52 0.42
53 0.4
54 0.36
55 0.33
56 0.33
57 0.32
58 0.28
59 0.26
60 0.22
61 0.23
62 0.25
63 0.24
64 0.2
65 0.16
66 0.14
67 0.12
68 0.12
69 0.1
70 0.07
71 0.09
72 0.09
73 0.09
74 0.08
75 0.07
76 0.07
77 0.08
78 0.09
79 0.07
80 0.07
81 0.08
82 0.1
83 0.11
84 0.12
85 0.1
86 0.09
87 0.1
88 0.12
89 0.12
90 0.16
91 0.16
92 0.18
93 0.19
94 0.21
95 0.21
96 0.21
97 0.2
98 0.15
99 0.16
100 0.16
101 0.16
102 0.18
103 0.19
104 0.19
105 0.25
106 0.33
107 0.4
108 0.45
109 0.48
110 0.46
111 0.51
112 0.56
113 0.58
114 0.55
115 0.5
116 0.43
117 0.41
118 0.4
119 0.37
120 0.3
121 0.22
122 0.17
123 0.15
124 0.14
125 0.14
126 0.15
127 0.1
128 0.1
129 0.1
130 0.13
131 0.14
132 0.2
133 0.26
134 0.29
135 0.36
136 0.4
137 0.44
138 0.51
139 0.57
140 0.6
141 0.62
142 0.7
143 0.74
144 0.79
145 0.87
146 0.87
147 0.87
148 0.86
149 0.88
150 0.88
151 0.88
152 0.89
153 0.89
154 0.88
155 0.86
156 0.8
157 0.79
158 0.74
159 0.71
160 0.7
161 0.69
162 0.69
163 0.71