Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RH68

Protein Details
Accession E3RH68    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
52-79VKQEQFKTPKKTKKVEKRKQSRMLIGKLHydrophilic
NLS Segment(s)
PositionSequence
41-75KPRKVGYRLSKVKQEQFKTPKKTKKVEKRKQSRML
Subcellular Location(s) nucl 20, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
KEGG pte:PTT_07234  -  
Amino Acid Sequences MSARTPFAFTDNPGFDYDAGSNEGHLLDMSTTGSSLEGGAKPRKVGYRLSKVKQEQFKTPKKTKKVEKRKQSRMLIGKLEKIKLELEKAEQMLREISLNTDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.24
4 0.22
5 0.16
6 0.16
7 0.14
8 0.13
9 0.12
10 0.12
11 0.09
12 0.09
13 0.07
14 0.05
15 0.05
16 0.06
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.06
24 0.07
25 0.12
26 0.15
27 0.16
28 0.16
29 0.19
30 0.21
31 0.21
32 0.27
33 0.31
34 0.39
35 0.46
36 0.48
37 0.54
38 0.54
39 0.59
40 0.59
41 0.54
42 0.52
43 0.54
44 0.6
45 0.62
46 0.67
47 0.69
48 0.7
49 0.76
50 0.77
51 0.79
52 0.82
53 0.83
54 0.85
55 0.87
56 0.9
57 0.91
58 0.87
59 0.85
60 0.82
61 0.77
62 0.75
63 0.67
64 0.64
65 0.58
66 0.53
67 0.44
68 0.38
69 0.35
70 0.29
71 0.29
72 0.25
73 0.25
74 0.27
75 0.29
76 0.29
77 0.27
78 0.25
79 0.23
80 0.21
81 0.19
82 0.14